KEGG   Rattus norvegicus (rat): 304344
Entry
304344            CDS       T01003                                 

Gene name
Ap4m1
Definition
(RefSeq) AP-4 complex subunit mu-1
  KO
K12402  AP-4 complex subunit mu-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    304344 (Ap4m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304344 (Ap4m1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    304344 (Ap4m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 304344
NCBI-ProteinID: NP_001033066
RGD: 1310233
Ensembl: ENSRNOG00000001353
UniProt: Q2PWT8
Position
12
AA seq 453 aa
MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGGESPVVMYHDDRHFIHIR
HSGLYLVATTSENVSPFSLLELLSRLATLLGDYCGSLNEGTISRNVALVYELLDEVLDYG
YVQTTSTDMLRNFIQTEAAVSKPFSLFDLSSVGLFGAETQQNRVAPSSAASRPVLSSRSD
QSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSSSEICIGLTEEFCVGKSE
LRGYGPGIRVDEVSFHSSVNLDEFESHRILHLQPPQGELTVMRYQLSDDLPSPLPFRLFP
SVQWDQGSGRLQVYLKLRCDLPPKSQALNIHLHLPLPRGVVSLSQELSSPDQKAELGEGA
LHWDLPRVQGGSQLSGLFQMDVPGLQGPPSRGPSPSAPPLGLGPASLSFELPRHTCSGLQ
VRFLRLSFSACGNANPHKWVRHLSHSNAYVIRI
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgatttcccagttcttcattctgtcttccaagggggatccgctcatctataaagacttc
cgaggggatagtggtggtcgtgatgtggccgagctcttctaccggaagctgacgggactg
ccgggaggcgagtccccggttgtcatgtatcacgatgatcgtcattttattcacatcaga
cacagtggtctctatttggtggccacaacttcagaaaatgtctctcctttcagcctcctg
gagctactttccaggttagccactctcttgggtgactactgtggctcactcaatgagggg
accatctcacggaatgtggcgcttgtctacgaactcctggatgaagtgctggattacggc
tatgtgcagactacgtccacagacatgctgaggaacttcatccaaactgaagccgcggtc
agcaagcctttcagcctcttcgacctcagcagcgtcggtctgtttggggcagagacgcag
cagaacagagtggccccaagcagtgcagccagccgccctgtcctgtccagtcgttctgac
cagagccaaaagaatgaagtgtttttagatgtggtcgaaaggctgtctgttctgattgca
tctaatggctccctgttgaaggtggatgtccaaggagagatccggctcaagagcttcctc
cccagcagttctgagatatgcattggcttgacagaagaattctgtgttggaaagtcagaa
ctgagaggttatgggccagggattcgagttgatgaggtgtcattccatagctctgtcaat
ctagatgagtttgaatctcatcggatcctccacctgcagccgcctcagggcgagctgact
gtgatgagataccagctctctgatgacctcccctcaccacttcccttccggctgtttccc
tctgtacaatgggaccaaggctcaggccggctccaggtttacctgaagttacggtgtgac
ctgcccccaaagagccaagctctcaacattcatctgcaccttcccctgcctcgaggggtc
gtcagcctgtctcaggaactgagcagcccagatcagaaggcagagctgggagaaggagcc
cttcactgggacctgccccgggtacaaggaggttctcaactctctggccttttccagatg
gatgtccctggcttgcagggacctcccagccgtgggccgtccccctcagcaccccccttg
gggctgggtcctgccagcctctcctttgaactccctcggcacacatgctctggcctccag
gttcgattcctcagactgtcctttagcgcctgtggtaatgccaaccctcacaagtgggtt
cgacatctaagccacagcaacgcctacgtaattcggatttga

KEGG   Rattus norvegicus (rat): 310746
Entry
310746            CDS       T01003                                 

Gene name
Ap4b1
Definition
(RefSeq) AP-4 complex subunit beta-1
  KO
K12401  AP-4 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    310746 (Ap4b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310746 (Ap4b1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    310746 (Ap4b1)
SSDB
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT
Other DBs
NCBI-GeneID: 310746
NCBI-ProteinID: NP_001101179
RGD: 1310529
Ensembl: ENSRNOG00000019455
UniProt: D4AD35
Position
2
AA seq 739 aa
MPYLGSEDVVKELKKALCNPHIQADRLRYRNVIQRVIRHMTQGLDMSDVFMEMVKASATV
DIVQKKLVYLYMGTYAPLKPDLALLAINTLCKDCSDPNPMVRGLALRSMCSLRMPGVQEY
IQQPVVNGLRDKASYVRRVAVLGCAKMHNLHGDSEVDGALVNELYSLLRDQDPIVVVNCL
RSLEEILKQEGGVVINKPIAHHLLNRMSKLDQWGQAEVLNFLLRYQPRSEEELFDILNLL
DSYLKSSSTGVVMGATKLFLILAKKFPHVQTDVLVRVKGPLLAACSSESRELCFAALCHV
RQVLHSLPGHFSSHYKKFFCSYSEPHYIKLQKVEVLCELVNDENVQQVLEELRGYCTDVS
ADFAQAAIFAIGNIAKTYTDQCVQILTELLGLRQEHITTVVVQTFRDLVWLCPQCTEAVC
QALPGCEENIQDSEGKQALIWLLGVHGEKIPNAPYVLEDFVESVKSETFPAVKMELLTAL
MRLFLSRPAECQDVLGRLLLYCIEEEKDMAVRDRGLFYYRLLLVGIDKTKQILCSPKSDP
SLGLLEDQPERPVNSWASDFNTLAPVYGKAHWATISKCQKIEPHRLELPHNASFATSGHL
IAEENKEGAQEPPDSGALVLVPNLQLTAECFEKTWLSLTVSYHQVLPWQGEVQPDTLQMA
LKVVNIQTIAMSKPGAQPWKAYLSAQDGTGGLFLTELLLKPENSEVQISVKQSEARTEAL
RGFVSVLETVIGTVGDIKS
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgccatatcttggctctgaggacgtggtgaaggaactgaagaaggctctgtgtaaccct
catattcaggctgataggctgcgctaccggaatgtcatccagcgagttattaggcacatg
actcagggcttggacatgtctgatgttttcatggaaatggtgaaggccagcgccactgta
gatatcgttcagaaaaagttggtttatctgtatatgggcacatatgcacctttaaaacct
gatctagcgctcttggctatcaatacactctgcaaagactgctcagaccccaacccaatg
gtgcgaggactggcactacggagcatgtgtagcctcaggatgcctggtgtacaggagtat
atccagcagcctgttgtcaatggtctgcgggacaaagcttcatatgtcagaagagtggcc
gtccttggctgtgccaagatgcataatcttcatggagactctgaagtagatggtgctcta
gtcaatgagttatacagtcttctgcgtgaccaggatccaattgtggttgtgaactgtctg
aggtctctagaggaaattttaaaacaggaaggaggtgttgtcattaataagcccattgcc
caccatctcttaaatagaatgtcaaaactggaccagtggggccaggctgaagtactgaac
tttctgctccgctaccaaccccgcagtgaggaggaactgtttgatatcctcaatttgttg
gacagctatctcaagagcagcagcactggtgtggtgatgggagccaccaaactttttctg
attttggcaaaaaagttcccccacgtacaaactgatgtgcttgtacgagtcaagggaccc
ttgctggctgcctgttcttcagagagccgagagctctgctttgctgctctctgccatgtc
cgccaggtcttgcatagtttgccaggtcactttagcagtcactacaaaaagtttttttgc
tcttactcggagccccactatatcaagctgcagaaggtggaggtgctgtgcgagctggtg
aacgatgagaacgtgcagcaggtgcttgaagagctgcgagggtactgcactgatgtgtct
gctgactttgcacaggctgccatctttgctataggtaatattgccaagacttacacagac
caatgtgtgcagattctaacagagttgctgggacttcgacaagaacatatcactacagtg
gtggtgcagactttccgagaccttgtctggttatgccctcagtgtactgaagctgtgtgt
caggccctgcccggctgtgaggagaacattcaagacagtgaggggaaacaggcacttatc
tggttacttggggtccacggggaaaaaatccccaatgctccttatgtgttggaggacttt
gtagaaagtgtgaagtcggagacttttcctgctgttaagatggagctgctgacggctctg
atgcgccttttcctctcacgccctgctgagtgccaggacgtgctgggacgtctgttgctt
tactgcatagaggaagaaaaggatatggctgtacgagaccggggtctcttctattatcgc
ctcctcttggttggcattgataaaactaagcagatcctgtgtagtcctaagtctgaccct
tctcttggacttttggaggatcaaccagaacgaccagtgaatagctgggcttcagacttc
aatacgctggcgccagtgtatggcaaagcccactgggcaactatctctaaatgccagaag
atagagcctcatcgccttgagcttccccacaatgcatcctttgccacatcaggacacttg
attgctgaagagaacaaagaaggagcacaagaacctccggactctggagctctcgtgctg
gttcccaatctccagcttaccgctgagtgttttgagaaaacatggcttagcctcacagtt
tcttaccatcaggtgcttccttggcagggagaagtccagcccgacactctacaaatggct
ctaaaagtagtgaacattcagaccatcgcaatgagcaagcctggggcacagccctggaaa
gcctacctcagtgctcaggacggtactggtggtctcttcttaacggaattgctgttgaag
cctgagaactcagaagtgcaaatctctgtgaagcagagtgaggccaggactgaagccctg
cgtggtttcgtctctgtcctggaaactgtgattggaacggttggagacataaaatcataa

KEGG   Rattus norvegicus (rat): 311404
Entry
311404            CDS       T01003                                 

Gene name
Ap4e1
Definition
(RefSeq) AP-4 complex subunit epsilon-1
  KO
K12400  AP-4 complex subunit epsilon-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    311404 (Ap4e1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311404 (Ap4e1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    311404 (Ap4e1)
SSDB
Motif
Pfam: Adaptin_N AP4E_app_platf Cnd1 Coatomer_b_Cpla Coatamer_beta_C
Other DBs
NCBI-GeneID: 311404
NCBI-ProteinID: NP_001178671
RGD: 1562199
Ensembl: ENSRNOG00000022938
UniProt: D3ZX21
Position
3
AA seq 1130 aa
MSDMVERTLTALPGLFLQNQLGGPAASRAPFFSRLGGLIRGVTALSSKHEEEKLIQQELS
SLKATVSAPTTTLKMMKECMVRLIYCEMLGYDASFGYIHAIKLAQQGNLLEKRVGYLAVS
LFLHESHELLLLLVNTVVKDLQSTNLVEVCMALTVVSQIFPREMIPAVLPLIEEKLQHSK
EIIRRKAVLALYKFYLIAPNQVQHIHTKFRKALCDRDVGVMAASLHIYLRMIKENSSGYK
DLTESFVTILKQVVGGKLPVEFSYHSVPAPWLQIQLLRILGLLGKDDERTSELMYDVLDE
SLRRAELNHNVTYAILFECVHTIYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALT
YVIQQDPSLALQHQITIIECLDHPDPIIKRETLELLYRITNAQNVVVIVQKMLEYLHQSK
EEYIIINLVGKIAELAEKYAPDNVWFIQTMNAVFSVGGDVMHPDILSNFLRLLAEGFDDE
TEDQQLRLYAVQSYLTLLDMENTFYPQRFLQVMSWVLGEYSYLLDRESPEAVMTRLYKLL
RSDSISSETKAWLFAAVTKLTPQAHSSPIVENLIQEFTVSLNTCLRQHAFELKHLHENEE
LMKSLLQSAQNCDDIMADASLSFLDGFVAEGLSQGAAPYKPRHQRQEEQLSQEKVLNFEP
YGLSFSSSGFTGRQSPAGVSLGSDISGNSAETGLKEAGSLKMDGIKKLWGKEGYLPKKES
GAADKLEAAHAPAESAMMENVDQAMTRKDQAQGHTPSTEEKEKQLLASSLFVGLGPENTI
NLLGKADVVSYKFRRKSKPKVAQSDKMPSAHAAPSSTLSPVSDVAGGDEDSLSAADRGDG
ELGSELLGSESVLELPSVENLSSVSLPVSSLFAGNDMEVFHPPSSSATSAVKEVSLAALL
EETPECRRSALVEICSNETVAVSSYKVWKDECLLLVCSVTSKTDSEFTDAQLEIFPLENF
KIIEQPGCPSPVMEAESTKSFQYGVQMESPCVEGTLSGFIKYQMMDTHPVQLEFSMNLSL
LDFIRPLKISTEDFGKLWLSFANDVKQNIKISEPRVALASVLTELQQKLRLCVVDVIGSE
GLLACKLLPSTPCILHCRVHADVVALWFRSSSSVLSDCLSCHCQKVMQTS
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgagcgacatggtggagaggacgctgaccgcactgccggggctcttcttgcagaaccag
ctgggagggcctgcggcctccagagcacccttcttctccaggctgggcggcctcatccgt
ggcgtcactgcgctctcatccaagcacgaagaagagaagttaatccagcaggaactgagt
agtctgaaggcgactgtttctgctcctactacaacactgaaaatgatgaaggaatgtatg
gtgagacttatatactgtgagatgcttggatacgatgcttcttttggttatatacatgca
atcaagttggcccaacaaggaaacctcttagaaaaaagagtgggttatttggctgtttct
ctgtttctacatgaaagtcatgaacttttgcttctccttgtgaatacagtggtaaaggac
ctgcagagcactaatctggtagaagtgtgtatggcactcactgtcgtcagccagattttc
cctcgagaaatgattccagctgtccttccactaatagaagagaaactccaacattctaag
gagattatacgaagaaaagcagttctggcattatacaaattttatctcattgcccctaat
caagtacagcatatccatactaagtttcggaaagcactctgtgacagagatgttggggtc
atggctgcctctttgcatatataccttaggatgattaaggaaaattcttctggatataaa
gacttgactgagagttttgtaacaattttaaagcaggtggtggggggaaagctccctgta
gagttcagttaccacagtgtgccagcgccatggttacagattcagctcttgagaatactg
ggactgctgggaaaagacgatgaaaggacaagtgaactaatgtatgatgttcttgatgaa
tccttacgaagagccgagttaaatcacaatgtcacttacgctattctgtttgagtgtgta
cacacaatctattctatttatcctaaatcagaattacttgagaaggctgccaagtgcatt
ggaaaatttgttctgtcacctaaaataaacctcaaatatttaggactgaaggctcttacc
tatgttatccagcaggatccttctctggctcttcaacaccagataaccataattgaatgc
ctagaccaccctgatcccattattaaaagagagactctggaacttctttacagaattaca
aatgcacagaatgtagtagttattgtacagaaaatgcttgaatatttacatcagagcaaa
gaagagtacatcatcatcaacttagtcggcaaaatagctgaattggctgagaaatatgct
cctgacaacgtgtggttcattcagacgatgaatgctgtgttttcagtgggaggagatgta
atgcacccagacattctcagtaactttctgagactgctagcagaaggttttgatgatgaa
acagaagatcaacagttaagactctatgcagttcagtcttacctcaccttactagacatg
gaaaacactttctatccacagagatttcttcaagttatgagttgggtattaggagagtat
tcctacctcttagatagagaaagccccgaggcagttatgaccaggctctacaagttactg
aggagtgactccatttcttcagaaacgaaagcatggttgtttgctgcagtaaccaagtta
acacctcaagctcattcttctcccatagttgagaacttaatccaagaattcactgtatcc
ttgaatacttgtctgagacaacatgcatttgaattgaaacatctacatgaaaatgaagag
cttatgaagagcttgcttcagagtgctcagaattgtgacgacatcatggcagatgcttct
ttatcttttctggatggttttgtggctgaaggactcagtcagggagcagcaccttataag
ccccgtcaccagcgccaagaggagcagctctctcaggaaaaagttctcaattttgaacca
tatggactatcattttcttcatctggcttcactggacgacagtctcctgctggcgtttct
ctgggctcagatatatctggaaacagtgctgaaacagggctgaaagaggcaggtagcctg
aagatggacggcataaagaaattatggggtaaagaaggttatctccccaagaaggagagt
ggagctgctgataaactggaagccgcacatgctcctgcagagagtgcaatgatggagaat
gtagaccaagccatgactaggaaggaccaagctcaaggccacaccccttctacagaggag
aaagaaaagcagctgttggcatcatcgctgtttgttgggctaggaccagaaaatacgatc
aatttgttgggaaaagcagatgttgtgtcttacaagttcaggaggaagtcaaaacccaag
gtagcccaaagtgacaagatgcccagcgctcatgccgctccctcctccacccttagccct
gtgtccgatgtggctgggggggatgaggacagtctgagcgctgcggatagaggagacggg
gagcttggttcagagctgttgggttctgagtctgtcttggagctgccctcagttgaaaac
ctctcgagtgtcagcttgcccgtgtcttctttgtttgcgggtaacgacatggaagtattt
catcccccttcatcctctgcaacttcagccgtcaaggaagtcagtttggctgctctgttg
gaagaaactcctgaatgcaggcgttcagctctcgtggaaatctgtagtaatgaaactgtg
gctgtgtcttcttacaaagtctggaaggatgagtgtttattgctggtgtgctcagtcact
agtaagactgattcagagttcacagatgctcaattagaaatttttcctttggaaaatttc
aagatcattgagcagcctggatgtccttcacctgtgatggaagcagaaagcaccaaatcc
ttccaatatggcgtgcagatggaaagcccttgtgtagaggggactctctctggttttata
aagtatcaaatgatggatacacatcctgttcaactggaattttccatgaacttatcacta
ctagattttattaggccattaaagatctcaactgaagactttggcaaactctggttgtct
tttgcaaatgatgtgaagcaaaatataaaaatatcagagcctcgagttgcactggcttct
gtcctgacagagctgcagcagaaactcagactttgcgtggttgacgtcataggcagtgaa
ggtctgctggcctgtaagctgcttccgtccaccccctgtatcctgcactgccgagtacac
gctgacgtggtagccctgtggttccgatcctctagctctgttctttcagactgtttatct
tgtcactgtcagaaagtgatgcagacatcctag

KEGG   Rattus norvegicus (rat): 366618
Entry
366618            CDS       T01003                                 

Gene name
Ap4s1
Definition
(RefSeq) AP-4 complex subunit sigma-1
  KO
K12403  AP-4 complex subunit sigma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    366618 (Ap4s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    366618 (Ap4s1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    366618 (Ap4s1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 366618
NCBI-ProteinID: NP_001124471
RGD: 1311990
Ensembl: ENSRNOG00000005765
UniProt: B0BN62 F1M5X2
Position
6
AA seq 144 aa
MIKFFLMVNRQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYR
QYAALFVVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
NT seq 435 nt   +upstreamnt  +downstreamnt
atgatcaagttcttccttatggtgaacagacaagggcagacccggctgtctaagtactat
gagcatgtagacattaataaacgtgcacttctggaaaccgaggtcagcaagagctgcctg
tcccgatccagtgaacaatgctcgttcattgaatacaaggatttcaaattgatctaccgg
caatacgcagctctctttgttgtggttggagttaatgacacggagaatgagatggctatc
tatgaattcatacacaattttgtggaagttttagatgaatacttcagcagagtgagtgaa
ctagatataatgtttaatttggacaaagtccacatcattttggatgagatggtgttaaat
ggctgcattgtggaaactaacagagcaagaattcttgccccgctactgattcttgacaag
atgtcggagagctga

DBGET integrated database retrieval system