KEGG   Rattus norvegicus (rat): 304346Help
Entry
304346            CDS       T01003                                 

Gene name
Mblac1, RGD1306932
Definition
(RefSeq) metallo-beta-lactamase domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 304346
NCBI-ProteinID: NP_001020167
RGD: 1306932
Ensembl: ENSRNOG00000001357
UniProt: Q6AYD1
Position
12q11
AA seq 251 aa AA seqDB search
MSGPVRTEPLHGETPLLASSGSYSVVVLLRGYAEPQGVGDAVRADGTVTLVLPRGWVSDT
SRRLAPSADGGAKTALEEAVRGPILVDTGGPWTRDALLEALATQGVAPGDVTLVVGTHGH
SDHIGNLGLFPQAALLVSHDFCLPGGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVS
VVVEGTSLGTVVVVGDVFERLGDEDSWQDLSEDPVAQQRSRERILSVADVVVPGHGAPFR
VVREAVKSSED
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtccagtgcgcactgagccgctgcacggcgagacccctctgctggcgtccagc
ggttcctactcggtggtggttctgctgcgcggctacgcggagccgcagggagtaggcgac
gcggtgcgtgcagatggcacggtgactctcgtcttgcctcggggctgggtctcggatacc
agccgccgattggccccatctgcagacggcggcgcaaagactgccctggaggaggcagtg
cgtggccccatcctcgtggacactgggggtccctggactcgggatgcactgctggaagcc
ctggctactcagggcgtggcccccggagatgtgactctggtggtgggcacccacgggcac
tcggatcatattgggaacctagggctgtttccccaggcggctctgttagtttcccatgac
ttctgccttcccgggggtctctatctgccccatgggctgtgtgaaacgcagcccttaata
ctgggctctggactgcaggtgtgggccacgccgggccacggaggacagcgggacgtgagc
gtcgtagtggagggcaccagcctgggcaccgtggtggtggttggcgatgtgttcgagcgt
cttggtgatgaggactcctggcaggacctgagtgaagacccagtagctcaacagcggagc
cgggagaggattctgagcgtggctgatgtagtggtgcctggtcacggagctccctttcga
gtggtcagggaagcagtgaaaagttcggaggattag

DBGET integrated database retrieval system