KEGG   Rattus norvegicus (rat): 304376Help
Entry
304376            CDS       T01003                                 

Gene name
Nyap1, RGD1310964
Definition
(RefSeq) neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NYAP_N NYAP_C
Motif
Other DBs
NCBI-GeneID: 304376
NCBI-ProteinID: NP_001100602
RGD: 1310964
Ensembl: ENSRNOG00000024641
UniProt: D3ZDP7
Position
12q12
AA seq 835 aa AA seqDB search
MNLLYRKTKLEWRQHKEEEAKRSSSKEAAPTGPVGSGAVPGPGVRVRDIASLRRSLRMGF
MTMPASQEHTPHPCRSAMAPRSLSCHSVGSMDSVGGGPGGGGGGLLEDSSTRRPPAKPRR
HPSTKLSMAGPGAETPPSRKAGSQKPTPECRESSRKVPPQKPRRSPNTQLSVSFDESCAP
APSPRGGNLPLQRLSRASRIAGDLDAGAQEEEPVYIEMVGDVFRGGGRSGGGLTGPPLGS
GGPTPPAAADSDSEDSEAIYEEMKYPLPEETGDGRANGPPPLMAPSPPQQPHVLQPHPHP
HRRPASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQAKSASRAPGDGVSRLPV
LCHSKESAGSTPAPQVPARERETPPLPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQTR
GERELPNSHSMICPKAAGVPAAHPAPAALLPGPPKDKAVSYTMVYSAVKVTTHSVLPAGP
PLGVGEPKTEEISVLHGMLCASSRPPVPGKSSPHSGAMGSAAGVLHHRSCLASPHSLPDP
TAGPLTPLWTYPATAAGLKRPPAYDSLKAGGVLSKGCGMGAPSPMVKIQLQEQGTDGGAF
ASISCAHVIASAGTPEEEEEMGATFGAGWALQRKVLYGGRKAKEVDKEDGARAWNGSTEG
PGKVEHEDRGSVASGIPVRSQGAEGLLARIHHDRGGSRTALPVPCQTFPACHRNGDFTGG
YRLGRSASTSGVRQAALHTPRPCSQPRDALSQTHPVLPLPLPPQPARERDGKLLEVIERK
RCVCKEIKARHRPDRGLCKQESMPILPSWRRGPEPRKSGTPPCRRQHTVLWDTAI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttctctaccgaaaaaccaagctggagtggagacagcacaaagaagaggaggcc
aaaaggagctccagtaaggaagcagcccccacaggcccggtggggtctggggctgtccca
gggcctggggttcgagtgcgggacattgcctcgcttcgacggtctctcaggatgggtttc
atgacaatgcccgcgtcccaggaacacacccctcacccctgccgcagcgccatggcccca
cgctcgctctcctgccactcggtgggcagcatggacagtgtgggtggtgggcctggagga
ggtggaggagggctcctggaggacagtagcacccggagacccccagctaagccgcggaga
caccccagcaccaagctcagtatggcagggccaggggccgagacaccgcctagtaggaaa
gcaggctcccagaagccaacccctgagtgccgtgagtccagccggaaggttcctccacag
aaacccaggcgaagccccaatacccagctgtctgtgtccttcgatgagtcttgtgcccca
gccccatctcctcgaggggggaatctgcccttgcaacgcctcagtagggcttctcgaata
gctggagacctggatgcaggtgcccaggaagaagagcccgtgtacattgagatggtaggg
gatgtctttcgtggaggaggacgaagtggaggaggtctgacgggacctcctcttggaagt
ggaggtccaaccccaccagctgcggccgattcggactctgaagacagtgaggctatatat
gaagagatgaaataccctctgcctgaagagacgggagatggcagggctaacgggcctcct
ccattgatggcaccctcccctccacaacagcctcatgtcctccagcctcacccccacccc
catcgccgtccagcttcagccctcccaagccggagggatgggacacccaccaagaccacc
ccttgtgaaatacccccaccctttcccaacctccttcagcatcggcctccacttctggct
ttccctcaagccaagtctgcttcacgagcccctggcgatggggtctcgaggcttccggtt
ctctgccactccaaggagtcagccggttccaccccagctccccaagtgcctgcacgagag
cgggagacacctcccctgccgcctccccctcctgctgccaacctgctattgctgggaccc
tcaggccgagcccggagccactcaacaccgttgccaccccagggctctggccagacccgg
ggagagcgggagctccccaactctcacagcatgatctgccccaaggcagcaggggtaccg
gcagcccaccctgccccagcagccttgctccccgggccccccaaggacaaggccgtgtca
tacaccatggtgtattctgcagtaaaagtaacaacacactcggtcctgccagctggtcca
cccctgggtgttggagagccaaagacggaggagatctcagttcttcacggaatgctgtgt
gccagttcgaggccccctgtcccagggaaatccagcccccacagcggggctatgggttca
gcggccggggttctccaccaccgcagctgcctggcctccccccacagccttccggatcca
actgcaggccccctgacccccctctggacctacccagccacagcagctgggctcaagaga
ccccctgcctatgacagtctcaaggctgggggggtgctgagtaagggctgtggaatgggg
gcaccatcccccatggtcaagatccagctacaagagcaagggaccgatgggggcgccttt
gctagcatctcctgtgcccatgttatcgccagcgcggggacgccagaagaggaagaagag
atgggtgccacatttggggcaggctgggctctgcagaggaaggtcctatatggaggacgg
aaagcgaaggaagtggacaaagaggacggtgcccgggcctggaatggcagcacagaaggt
ccaggcaaagtcgagcatgaggacaggggctctgtggcatcagggattcccgtgaggagc
cagggggcagagggtctgctggccaggatccaccatgatcgaggagggagccgcacagcg
ctgccggtcccttgccagactttcccagcctgccaccggaatggagatttcacaggaggg
taccgcctgggccgttctgcctccacctctggagtccgtcaggctgcgctccatacccct
cggccctgcagccagcccagggatgccctgagccagacacaccctgtgctgcccctgccc
ctgccaccccagccggcccgggagcgcgatggcaaacttctagaggtgatcgagcgcaaa
cgctgcgtgtgcaaggagatcaaggcacgccaccgtcccgaccgggggctctgcaagcaa
gagagcatgcctatcctccccagctggcggcggggccctgaaccccgcaagtctggtacc
ccgccctgccggcggcagcacacggtcctctgggacactgccatttga

DBGET integrated database retrieval system