KEGG   Rattus norvegicus (rat): 304407Help
Entry
304407            CDS       T01003                                 

Gene name
Cldn4
Definition
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    304407 (Cldn4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    304407 (Cldn4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    304407 (Cldn4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    304407 (Cldn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    304407 (Cldn4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   304407 (Cldn4)
  Exosomal proteins of colorectal cancer cells
   304407 (Cldn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl SUR7 Amastin TMEM37
Motif
Other DBs
NCBI-GeneID: 304407
NCBI-ProteinID: NP_001012022
RGD: 1307932
Ensembl: ENSRNOG00000001476
UniProt: Q5XIT8
Position
12q12
AA seq 210 aa AA seqDB search
MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG
QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMIT
AGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGL
LCCNCPPRRNEKPYSAKYSAARSVPASNYV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatggggctgcaggtgctgggaatctccttggccgtcctgggctggttagga
gtcatcctgagttgttcgctccccatgtggcgggtgaccgccttcatcggcagcaacatc
gtcacggcgcagacgagctgggaaggcctgtggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaagatgtacgactcgatgctggccctgccgcaggacctgcaggccgcc
cgagccctgatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtcgta
gggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaaggtcatgatcaca
gccggagccgtgttcatcgtggcaagcatgctgattatggtgcctgtgtcctggacggca
cacaacgtcatccgcgacttctacaaccctctggtggcttccgggcagaaaagggagatg
ggggcctcgctttacatcggctgggcggcttctgggctgctgctcctgggaggaggcctc
ctctgctgcaattgcccacctcgccgcaacgaaaagccctactccgccaagtactccgcc
gcccgctctgttcccgccagcaactatgtgtaa

DBGET integrated database retrieval system