KEGG   Rattus norvegicus (rat): 304410
Entry
304410            CDS       T01003                                 

Gene name
Gatsl2, Gats
Definition
(RefSeq) GATS protein-like 2
  KO
K23081  cytosolic arginine sensor for mTORC1 subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    304410 (Gatsl2)
SSDB
Motif
Pfam: ACT_7 Castor1_N
Other DBs
NCBI-GeneID: 304410
NCBI-ProteinID: NP_001094031
RGD: 1304672
Ensembl: ENSRNOG00000001484
UniProt: G3V665
Position
12q12
AA seq 329 aa
MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTRCKFFSLTETPEDYTIIVDEEGF
LELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTY
QTDFILVRERDLPFVTHTLSSEFTILRVVNGETVAAENLSITNGFVKPKMVQRPVIHPLS
SPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMASSDDCGHIRFFSFSLIEGYISL
VMDVQTQQRFPSHLLFTSASGELWKMVRIGGQPLGFDECGIVAQISEPLAAADIPAYYIS
TFKFDHALVPEENISGVIHALKVSQAGKH
NT seq 990 nt   +upstreamnt  +downstreamnt
atggaactgcacattctggaacaccggctgcaagttgccagcgtcgccaaggagagtatc
ccgctcttcacctacggcctcatcaaacttgccttcctgtcttccaagaccaggtgcaag
tttttcagtctgacagagacccctgaggactacaccatcattgtagatgaggagggcttc
cttgagctgccctcctcagagcacctgagcgtggctgatgccacctggctggccctgaat
gtggtgtccggtggcggcagcttctccagttcccagcccatcggtgtgacaaagatcgcc
aagtctgtcatcgctccactggccgaccagaacatctctgtgttcatgctctctacctac
cagactgacttcatcctggtgcgagagcgtgacctgcccttcgtcactcacaccttgtcc
tcggaattcaccatccttcgtgttgtcaatggagaaacggtagcggctgagaatctcagc
atcaccaatggctttgtgaagcctaaaatggtccagaggccagtcatccacccactctcc
agcccaagcaacagattctgcgtcaccagcctggaccctgacacgctgcccgccgttgcc
accctcctcatggatgtgatgttctactccaatggagtgaaggaccccatggcttccagt
gacgactgtggccacatccgcttcttctctttctcactcattgagggttacatctcactg
gtgatggatgtgcagacccagcagaggttcccgagtcatttactattcacgagtgcatcc
ggagagctctggaagatggtgcgaataggaggacaacccttgggattcgacgagtgtggg
attgtagcccagatctccgagcccttggcagctgcagacatcccagcatattacatcagt
actttcaagttcgaccatgcgttggttccagaagagaatatcagcggggttatccatgcc
ctgaaggtcagtcaagcagggaagcattag

DBGET integrated database retrieval system