KEGG   Rattus norvegicus (rat): 304429
Entry
304429            CDS       T01003                                 

Gene name
Psph
Definition
(RefSeq) phosphoserine phosphatase
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    304429 (Psph)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    304429 (Psph)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     304429 (Psph)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Other HAD phosphatases
   304429 (Psph)
SSDB
Motif
Pfam: Hydrolase HAD UMPH-1 HAD_2 Put_Phosphatase StbA
Other DBs
NCBI-GeneID: 304429
NCBI-ProteinID: NP_001009679
RGD: 1308764
Ensembl: ENSRNOG00000000925
UniProt: Q5M819
Position
12q13
AA seq 225 aa
MVSHSELRKLFCSADAVCFDVDSTVIREEGIDELAKFCGVEAAVSEMTRRAMGGALPFKD
ALTERLALIQPSRDQVQRLLAEHPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
AKLNIPTTNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIGFLKEKFHFKKIIMIGDG
ATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtctcccactcagagctgaggaagctcttctgttcggctgatgcagtgtgctttgat
gttgatagcacagtcatcagagaagagggaatcgatgagctggccaaattctgtggtgtg
gaggctgcagtgtctgaaatgacacggagagccatgggaggagcgttgcctttcaaagat
gcgctcactgagcgcctggcactgatccagccctccagggatcaggtgcagaggctgctg
gctgaacacccgccacacctgaccccggggataagggagctggtaagccgcctccaggag
cggaatgttcaggtgttcctcatctccgggggctttaggagtattgtggagcacgttgct
gcaaagctcaacatccccacaaccaatgtctttgccaataggctgaaattctacttcaac
ggtgagtacgcaggttttgacgagacgcagccgacagccgagtcaggtgggaaaggaaag
gttattggatttttaaaggaaaaatttcactttaagaaaataatcatgattggagacgga
gccacagacatggaagcctgccctcccgctgatgccttcattggctttggaggcaacgtg
atcaggcagcaggttaaggacaatgccaagtggtacatcactgactttgttgaactgcta
ggagaactggaagaatga

DBGET integrated database retrieval system