KEGG   Rattus norvegicus (rat): 304496
Entry
304496            CDS       T01003                                 

Gene name
Orai1
Definition
(RefSeq) calcium release-activated calcium channel protein 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04611  Platelet activation
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    304496 (Orai1)
   04024 cAMP signaling pathway
    304496 (Orai1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    304496 (Orai1)
  09152 Endocrine system
   04924 Renin secretion
    304496 (Orai1)
   04925 Aldosterone synthesis and secretion
    304496 (Orai1)
   04927 Cortisol synthesis and secretion
    304496 (Orai1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    304496 (Orai1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    304496 (Orai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    304496 (Orai1)
Ion channels [BR:rno04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   304496 (Orai1)
SSDB
Motif
Pfam: Orai-1 DUF687
Other DBs
NCBI-GeneID: 304496
NCBI-ProteinID: NP_001014004
RGD: 1311873
UniProt: Q5M848
Position
12
AA seq 304 aa
MHPEPAPPPNNSNPELPLSGGSSTSGSRRSRRRSGDGEPTGAPPLPPPPAVSYPDWIGQS
YSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGL
LIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFS
TVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPTEPAVVVANSSNNGGITPGEAAAI
ASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPG
THYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcatccggagcctgccccgcccccgaacaacagcaatccggagcttcccttgagcggc
ggcagcagcactagcggcagccgccggagccgccgccgcagcggggacggggagcccacg
ggggccccaccgctgccgccgccgcccgccgtcagctacccggactggatcggccagagt
tactccgaggtgatgagcctcaacgagcactcgatgcaggcgctgtcctggcgcaagctc
tacttgagccgcgccaagctcaaagcctccagccgaacctccgctctgctctccggcttc
gccatggtagcgatggtggaagtccagctggacacggatcatgactacccgccagggtta
ctcatcgtcttcagcgcctgcaccacagtgctggtggccgtgcacctgttcgccctcatg
atcagtacctgcatcctgcccaacatcgaggctgtgagcaacgtccacaacctcaactcc
gtcaaggagtcgccgcacgagcgcatgcaccgccacatcgagctggcttgggccttctcc
accgtcatcgggacgctgcttttcctggccgaagtcgtgctgctctgctgggtgaagttc
ttaccgctcaagaggcaggcgggacagccaagccccaccaagccacccaccgaaccggcc
gtcgtcgtcgccaacagcagcaacaacggtggcatcaccccgggtgaggcggctgccatc
gcctccactgccatcatggtcccctgtggcctggtgtttatcgtctttgccgttcacttc
taccgctcactggtcagccataagacggaccgacagttccaggagctcaacgagctggcc
gagtttgcccgcttgcaggaccagctggaccacagaggggaccattctctaacaccgggc
acccactatgcctaa

DBGET integrated database retrieval system