KEGG   Rattus norvegicus (rat): 304567
Entry
304567            CDS       T01003                                 

Gene name
Pus1
Definition
(RefSeq) pseudouridylate synthase 1
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    304567 (Pus1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     304567 (Pus1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    304567 (Pus1)
 Prokaryotic type
    304567 (Pus1)
SSDB
Motif
Pfam: PseudoU_synth_1
Other DBs
NCBI-GeneID: 304567
NCBI-ProteinID: NP_001020734
RGD: 1311871
Ensembl: ENSRNOG00000037500
UniProt: Q4KM92 B1WBN5
Position
12q16
AA seq 423 aa
MGFPRLWAALLRAWGRWTARPGPRVPGLPPMAGNKVPPALPSHQPDRKGRGGWVWEETEH
PAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNLGSSQFRTIEDDLVSALVQAG
CIPENHGTDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILDKINSHLPSHIRILGLK
RVTGGFNSKNKCDARTYCYMLPTFAFAHKDRDVQDESYRLSAETLQQVNRLLGCYKGTHN
FHNFTSQKGPREPSARRYILEMYCEEPFVREGLEFAVIKVKGQSFMMHQIRKMVGLVVAI
VKGYAPESVLERSWGEEKVDVPKAPGLGLVLERVHFEKYNQRFGSDGLHEPLDWAQEEGK
VTAFKEQYIYPTIVSTERDERSMAQWLNTLPIHNFSGTALGADDTGAKVPSSLEGSEGDG
DTD
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgggcttcccccgcctgtgggccgcactgctgagagcctggggacggtggacggcgcgc
ccaggcccgcgcgtgcccggcctgccgcctatggctggaaacaaggtgccaccagcgctg
ccctcacaccagccggacaggaagggccgaggtggctgggtttgggaggagacggagcat
cctgccaagagggtcaagggcggtgaggatgaagagcctccacgcaagctgccaaagcgc
aaaattgtgctgctcatggcctactccggcaagggctaccacggcatgcagaggaatctg
gggtcctcccagttcaggaccatcgaagatgacttggtatctgccttagtccaggcaggt
tgtatccctgaaaaccatggcacagatatgaggaagatgtctttccagcgatgtgctcgc
acagacaagggtgtgtctgcagctgggcaggtggtatccctaaaggtgtggctaattgat
gacatcctggacaagatcaacagccaccttccatcccatattcggattctgggactgaag
agggtcacaggtgggttcaactccaagaacaagtgtgacgccaggacctattgctacatg
ctacctacctttgcctttgctcataaggaccgggatgtacaggatgagagctatcgccta
agtgcagagaccctgcagcaggtcaaccggcttctgggctgctacaaaggcacgcataac
ttccataacttcacatcacagaaggggccgagagagcctagtgcacgccgctacattctg
gagatgtactgcgaggagccctttgttcgggagggcctggagtttgctgtgatcaaggtg
aagggccagagcttcatgatgcaccagatccggaagatggttggcctggtggtagccatt
gtcaagggttatgcccctgagagtgtcctggagcgaagttggggtgaggagaaggtggat
gtgcccaaggcaccagggcttggcttagtcctggagagggttcactttgagaagtacaat
caacgctttggcagtgacgggctgcatgagcccctggactgggcacaggaggaagggaag
gtgactgctttcaaggagcaatacatctaccctaccattgtcagcactgagcgggatgag
cggtccatggcccagtggcttaacactttgccgatccacaacttcagtggcactgcactt
ggagcggatgacacaggtgccaaggtccccagctccctggagggcagtgaaggggatgga
gacactgactga

DBGET integrated database retrieval system