KEGG   Rattus norvegicus (rat): 304578
Entry
304578            CDS       T01003                                 

Gene name
Alkbh2, RGD1306377
Definition
(RefSeq) alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
  KO
K10859  DNA oxidative demethylase [EC:1.14.11.33]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    304578 (Alkbh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.33  DNA oxidative demethylase
     304578 (Alkbh2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    304578 (Alkbh2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 304578
NCBI-ProteinID: NP_001119745
RGD: 1306377
Ensembl: ENSRNOG00000028584
UniProt: B2GV68
Position
12q16
AA seq 239 aa
MDRFLVRPDRGDIQGAAEEPAPTGEASGDMQSPGWQHFRAEGLNCDYTVLFRKAEADQIF
RELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWIPVLERVR
DQVCRVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDILFRHKDS
RGKRPRRAVEVVRLQLAHGSLLMMNHPTNTHWYHSLPIRKRVLAPRINLTFRKILPTKK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggacagattccttgtgagaccggaccgaggcgacatccaaggggccgcggaggagccc
gcccctacgggagaagcctcaggcgacatgcagagccccggctggcaacactttcgcgcg
gaaggtctgaactgcgattacaccgtcctgttccgcaaggccgaggcagaccagattttc
cgagagttggagcaagaagtggagtattttaccggtgcactggccaaggtgcaggtgttc
ggaaagtggcacagtgttcccaggaagcaggcaacctatggggacgctggcctcacatat
acgttttctggtcttaccctgacaccaaagccgtggattccggttctagagcgcgttcga
gaccaagtctgcagggtgacaggacagaccttcaactttgtgctcgtgaacaggtacaaa
gacggctgtgaccacattggggagcacagagacgatgaacgagaactggccccggggagc
cccatcgcgtccgtctccttcggtgcctgcagagacatcctcttccggcacaaagactct
cgggggaagaggccccggagggcagtggaggtggtcaggctgcagctggcccatggaagc
ctgctgatgatgaaccaccccaccaacacccactggtaccacagtctccccatccgcaag
agggtcctggctcctcggatcaacttgacttttaggaaaattttacctactaagaaataa

DBGET integrated database retrieval system