KEGG   Rattus norvegicus (rat): 304592Help
Entry
304592            CDS       T01003                                 

Gene name
Orai2, RGD1310213
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 2
  KO
K16057  calcium release-activated calcium channel protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    304592 (Orai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    304592 (Orai2)
Ion channels [BR:rno04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   304592 (Orai2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orai-1 DUF4199 DUF2207
Motif
Other DBs
NCBI-GeneID: 304592
NCBI-ProteinID: NP_001163874
RGD: 1310213
Ensembl: ENSRNOG00000001427
UniProt: B2ZDP9 B0BNI3
Position
12q12
AA seq 313 aa AA seqDB search
MGHVTAAQRCLGSGCGRKEGGGRSSALARLPGHPAPTQTLATSRSGELEPSALRASQPGL
VPTMSAELNVPMDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
AKLKASSRTSALLSGFAMVAMVEVQLETKYQYPQPLLIAFSACTTVLVAVHLFALLISTC
ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
AKDQPGSHSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKLK
VQLDGHERSLQVV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacgtgacggcggcgcagcgttgcctaggcagcggctgcgggcggaaagaggga
gggggccggtcctccgccctggcccggctgccgggccacccggccccgacacagacgcta
gccacgagccggagcggagaactggagccaagcgcgctgagggctagccagccaggcctg
gtccccaccatgagtgccgagctcaatgtgcccatggacccctctgcccccgcctgccct
gaacccggccacaagggcatggattaccgagactgggtccgacgcagctacctggaactg
gtcacatccaaccaccactcggtgcaggccctgtcctggaggaagctgtacctgagcagg
gccaagctgaaggcctccagccggacctctgccctcctgtccggcttcgccatggtggcc
atggtggaggtgcagctggagaccaagtaccagtaccctcagcccctgctcatcgccttc
agcgcctgcaccacggtgctggtagccgtgcacctatttgccctgctcatcagcacatgc
atcctgcccaacgtggaagccgtgagcaacatccacaacctcaactccatcagcgagtcg
ccgcacgagcgcatgcacccgtacatcgagcttgcctggggcttctctaccgttctgggc
atcctgcttttcctggctgaggtggtcctgctctgctggatcaagttcctcccagtggat
gccaaggatcagccaggctcgcatagccacacgggctggcaggccgctctggtgtccacc
atcatcatggtacctgtgggtctcatcttcgtggtctttactatccacttctaccgctcc
ctggtgcgacataagacagagcgccacaaccgtgagatcgaggaactgcacaagctcaag
gtgcagctggatgggcacgagagaagcctacaggtggtgtga

DBGET integrated database retrieval system