KEGG   Rattus norvegicus (rat): 304692Help
Entry
304692            CDS       T01003                                 

Gene name
Serpinb12, RGD1566382
Definition
(RefSeq) serpin family B member 12
  KO
K13966  serpin B11/12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    304692 (Serpinb12)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   304692 (Serpinb12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 304692
NCBI-ProteinID: NP_001129339
RGD: 1566382
Ensembl: ENSRNOG00000002602
UniProt: D3ZPF9
Position
13p11
AA seq 421 aa AA seqDB search
MDSLVAANNKFCFDFFQEISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAQQIDEVLHF
NELPKDERKEPSEPSSKSKASDSSLEGQKQTTASQGQQGESTNEHRLLGCHFGKLLSRID
RDKAHYTLSMANRLYGEQEFPICPEYSDDITEFYHTTIESVDFQKDTEKSREEINFWVES
QSQGKIKELFDKEAIDNSTVLVLVNAVYFKAKWEKEFDSENTVDAPFCLSENEKKTVKMM
NQKGQFRIGFIEELQAQILEMKYTTGKLSMLVLLPSSSEDNVKSLQELEKKINHEKLLAW
SNPENMSEKPVAISFPQFIMEDSYDLNSVLQDMGIRDVFDGTKADLTGISKSPSLHLSKV
VHKTFVEVDEMGTQAAAASGAVVAEKALPSRVEFNANRPFLFFIRHNGTQSLLFCGRVYS
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggactctcttgttgcagcaaataacaaattttgcttcgattttttccaagagattagc
aaagatgatgctcataaaaatatctttgtatgccctctgagtctctcagctgcctttggt
atggtccgcctgggagctagaggggacagtgcacaacagattgatgaggtattacatttc
aatgagcttcccaaggatgaacgcaaagagcccagtgaaccctcttcaaaaagcaaagca
tctgacagctctctggaagggcaaaaacaaaccacagcttctcagggtcagcagggtgaa
tctacaaatgagcatcgattgcttggctgccactttgggaaacttctctccagaatagac
agagacaaagctcattatactctgagtatggccaacagactctatggagagcaggaattc
ccaatctgcccggaatactctgatgacataactgaattttaccacacaacaatcgaaagt
gtagatttccagaaggatacggagaaatcaagagaagagattaacttctgggttgaaagt
caaagccaaggaaaaatcaaagaactgtttgacaaggaggctattgataattcgactgtg
ctggtgctggtgaatgctgtttacttcaaggccaagtgggagaaagaattcgactctgaa
aacactgttgatgcacctttctgtctcagtgagaatgaaaagaagactgttaagatgatg
aatcagaagggtcagtttagaattggcttcattgaggagctgcaggcacagatcctggaa
atgaagtataccacgggcaaactcagcatgctggtcctgcttccatcttcctcagaagac
aatgtgaagagcctgcaagagcttgaaaagaaaataaaccacgaaaaactacttgcctgg
agtaacccagaaaacatgtcagaaaaacccgtagccatttccttcccccagttcatcatg
gaagatagctacgacctcaactcggttctacaggatatgggcattagggatgtctttgat
ggaacaaaggctgaccttactggaatctctaagagtcccagtctgcatttgtccaaagtt
gtccacaagacctttgtggaagtggatgagatgggcacccaggcagctgcagccagtggg
gctgtggttgcagagaaggcccttccgtccagggtggaatttaatgccaaccgcccattc
ctctttttcatccgacacaatggaacccagagtctacttttctgtggcagagtctactcc
ccttga

DBGET integrated database retrieval system