KEGG   Rattus norvegicus (rat): 304775
Entry
304775            CDS       T01003                                 

Gene name
Dyrk3
Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 3
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    304775 (Dyrk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     304775 (Dyrk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   304775 (Dyrk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Choline_kinase RIO1 YrbL-PhoP_reg TCAD9
Other DBs
NCBI-GeneID: 304775
NCBI-ProteinID: NP_001019938
RGD: 1310924
Ensembl: ENSRNOG00000004870
UniProt: Q4V8A3
Position
13
AA seq 586 aa
MGGAARERGRKDAALPGAGLPPQQRRLGDGVYDTFMMIDETKCPPYTNTLCNPSEAPVSR
RLNITTEPFTRGHTQHFVSGGVMKVEQLFQEFGSRRTSTLQSDGVSNSEKSSPASQGKSS
DSLGTVKCSLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIISYPEIYFVGPNAKKRQGV
IGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVR
NEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKK
NKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCF
EYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACM
MELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVTTQTDGRVVLLGGRSRRGKKRGPPGSK
DWAAALKGCDDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSAPRPLTTDKVSGKRVV
NPTNAFQGLGSKLPPVVGIASKLKANLMSETSGSIPLCSVLPKLIS
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgggaggcgcagcccgcgagcgcgggaggaaggacgcggcgctgccgggggccgggctc
ccgccgcagcagcggaggttgggggatggtgtctatgataccttcatgatgatagatgaa
accaagtgcccaccctatacaaacacactttgcaatccctctgaagcacctgtctccaga
aggctaaatattaccactgagccattcacgagaggccacactcagcacttcgtgagtggg
ggtgtgatgaaggtggagcaactgtttcaagaatttggcagcagaagaaccagtactctc
cagtccgatggcgtcagcaactccgaaaagtcctctcctgcttctcaggggaagagttca
gacagcctgggtacagtgaagtgcagcctctcatccagaccatctaaggtgctcccgctg
actcctgagcaagctctgaagcagtacaagcaccacctcaccgcctacgagaagctggag
atcatcagctacccagaaatctacttcgtgggcccgaatgccaagaagcggcaaggagtt
attggtggtcccaataacggggggtacgacgatgcggacggggcctatatccacgtgcct
cgagaccatctggcttaccgctatgaggtgctgaaaattattggcaaggggagttttgga
caggtagcccgggtctacgatcacaaactccgacagtacgtggccctgaaaatggtgcgc
aacgagaagcgctttcaccgccaggcagccgaggagatccggattctggagcatcttaaa
aagcaagacaaaactgggagcatgaatgtcatccacatgttagaaagcttcaccttccgg
aaccacgtgtgcatggcctttgagttgctaagcatagacctgtacgagctcattaaaaaa
aacaagtttcagggcttcagcgtccagttggtccggaagttcgcccagtccatcctgcag
tccttggacgcccttcacaaaaataagatcattcactgtgatctgaagcctgagaacatt
ctcctgaagcatcacggacggagcgcgaccaaggtcattgacttcgggtccagctgtttt
gagtatcagaaactttacacgtacatccagtcccgtttctacagagccccggaaatcatc
ttggggtgccgctacagcacgccaattgacatatggagttttggttgcatcctcgcagaa
cttttgacaggacagcccctgttcccaggagaggatgaaggagaccagttggcctgcatg
atggagttgctaggaatgccaccacagaaacttctggagcaatccaaacgtgccaagtac
tttattaactccaaaggcttgcctcgatactgctccgtaactacccagacggacgggagg
gttgtgcttctcgggggccgctcacgcaggggtaaaaagcgaggcccaccaggcagcaaa
gactgggcagccgcgctgaaggggtgcgatgactacttgttcatagagtttctgaaaagg
tgccttcagtgggacccctctgcccgcctcaccccagctcaagcattaagacatccttgg
attagcaagtctgcacccaggcccctcaccacggacaaggtgtcagggaaacgggtagtt
aatcctacaaatgctttccagggactgggctccaagctgcctccagtcgttggaatcgcc
agtaagcttaaagctaacctaatgtcggaaaccagtggtagtatacctctgtgcagtgta
ttgccaaagctgatcagctaa

DBGET integrated database retrieval system