KEGG   Rattus norvegicus (rat): 304786
Entry
304786            CDS       T01003                                 

Gene name
Elk4
Definition
(RefSeq) ETS domain-containing protein Elk-4
  KO
K04376  ETS domain-containing protein Elk-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    304786 (Elk4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    304786 (Elk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    304786 (Elk4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    304786 (Elk4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    304786 (Elk4)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 304786
NCBI-ProteinID: NP_001100643
RGD: 1310504
Ensembl: ENSRNOG00000007887
UniProt: B4F7D4
Position
13
AA seq 430 aa
MDSAITLWQFLLQLLQEPQNEHVICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLS
RALRYYYVKNIIKKVNGQKFVYKFVSYPEILKMDPLTVGRIEGDCETLNSIEASSSKDAE
CGGKERPPQPGAKTSSRNDYIHSGLYSSFTLNSLNTSNKKLFKSIKIENPAEKLAEKKAQ
EPTPSVIKFVTTPAKKPPMEPVTVAFSTSPSVSPSSEETIQALETLVSPTLPSLEASASV
SILATTFNPTPPVPSIPLPLQEPPRTPSPPLSSNPDIDTDIESVAPQPMERPENLSLEPK
NEDSALPEKDKTNNSSRSKKPKGLELTPALVVTGSDPSPLGILSPSLPTASLTPALFSQT
PILLTPSPLLSSIHFWSTLSPFAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTP
GPFSPDLQKT
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggacagtgccattactctgtggcagttccttcttcagctcctgcaggagcctcagaat
gagcacgtgatctgctggacctctaacaatggggagttcaagcttctgcaggcggaggag
gtggctcgcctgtgggggatccgaaagaacaagcctaacatgaattatgacaaactcagc
cgagccctgagatactactacgtaaagaacatcattaaaaaagtgaatggtcagaagttt
gtatacaagtttgtctcctatccagagattttgaaaatggatccactgacggtaggcagg
attgagggagactgtgaaactttaaattccattgaagccagcagttccaaagatgctgag
tgtggaggaaaggagaggccacctcagcctggagccaagacatccagtcgcaatgactac
atacactctggtttgtattcttcctttactctcaactctctgaacacctccaataagaag
cttttcaagtcaataaagatagagaatccagcagaaaaactagcagagaagaaagctcag
gagccaaccccgtccgtgatcaaattcgtgacaacacctgccaaaaagccgcccatggag
cctgtcactgttgccttttcaacaagccctagtgtttctccatcttctgaagaaactatc
caagctttggagactctggtctctcccacactaccttccctggaagcctcagcctctgta
tccatcctggctaccacctttaaccccactcctccagttccttccataccccttcctcta
caggagcctcccaggacaccgtctccaccgctgagttctaacccagacattgacacagac
attgaatcagtggctcctcagcccatggaacgtccagagaacttgtcactggagcctaaa
aatgaggattcagctttgccagaaaaggacaaaacaaataactcatcaagatccaagaag
ccaaaagggttagaactgacgcccgcccttgtggtcacaggcagtgaccccagccccttg
gggatcttaagcccgtctctcccaacagcgtcgcttacaccagcactcttctcacagaca
cccatcctgctgacgccgagccccttgctctccagcatccacttttggagcactctcagc
ccgtttgctcctctgagcccagccagactgcaaggtgctaatacgctcttccagttccct
tctgtactgaacagtcatggaccattcactctgtctggcctggatggaccttccactccg
ggcccgttttctccagacctgcagaagacataa

DBGET integrated database retrieval system