KEGG   Rattus norvegicus (rat): 304791
Entry
304791            CDS       T01003                                 

Gene name
Dstyk, DustyPK, Ripk5
Definition
(RefSeq) dual serine/threonine and tyrosine protein kinase
  KO
K16288  dual serine/threonine and tyrosine protein kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    304791 (Dstyk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     304791 (Dstyk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  Other
   304791 (Dstyk)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo Kinase-like Baculo_gp41 APH
Other DBs
NCBI-GeneID: 304791
NCBI-ProteinID: NP_955750
RGD: 735051
Ensembl: ENSRNOG00000021298
UniProt: Q6XUX2
Position
13q13
AA seq 927 aa
MEADGQSWSGESVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHS
HSCPSSPAGGGAAELGPAGDVAAAPLPAGQLSCISFPPMEEKYLQQIVDHLPCILILGQD
CNAKCQLLNLLLAVRVLPTLKLDSDESCKLRRLRFTYGTRTQVSLALPGQYELVHTLASH
QDNWETIPEEDLEVQEDSEDTARVLADLEVTMHHALLQEVDIVVAPCHSHRPAVDVLSDL
ANDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFKVPTLEIIRSSSGRADSERSP
LSGQLMDLGYLSSSHRNCMASDQDCRAQSMLVEQSEKLRQLSTFSHQLLQTRLVDAAKAL
NAVHSHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVE
TLNTMKEELLDDAANMEFKDVIVPENGETVGTREIKSCIRQIQELIISRLNQAVANKLIS
SVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLW
EQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAA
SLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQ
YGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNY
GGGSSVAVLLIMERLHRDLYTGLKAGLSLETRLQIALDVVEGIRFLHSQGLVHRDIKLKN
VLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYIC
SGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPSKRPLLGIV
QPILRSIMDRLCKCDSERPSRGLDDST
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggaggccgacgggcagtcgtggtccggcgagtccgtgtcgggcccgggcccggggggc
ggcggaatgatccgcgagctgtgccggggcttcggccgctaccgccgctacctgggacgg
ctgcggcagaacctgcgtgagacccagaagttcttccgcgacatcaagtgctcccacagt
cacagttgtccctcctcccccgcgggcggcggcgcggcggagcttggccctgccggcgac
gtcgccgcagccccgctgccagcgggccagctgagctgcatttcctttccacctatggaa
gagaagtatctgcagcagatcgtggatcacctcccctgtatactgatcctcggccaggac
tgtaatgccaagtgccagctgttgaacctgctgttggcggtgcgggtgcttcccaccctc
aagctggacagtgacgagagctgtaagcttcggcgcctccgcttcacctacgggactcgg
actcaggtcagcctggcgctgcccggtcagtatgagctggtgcacacactggcttcccac
caggacaactgggagaccatccctgaggaggacctggaggttcaagaagacagtgaggac
actgcccgtgtgttagctgaccttgaggtgacaatgcaccatgctctcctacaggaagtg
gacattgtggtggcaccatgccacagccaccggcctgcagtagatgttctgagtgacttg
gcaaatgatttcttgcctgtgataacctacgcacttcacaaagatgaactctctgaacgg
gatgagcaagagcttcaggaaattagaaagtatttctcgtttcctgtgttcttcttcaaa
gtacctacactggagatcatccgctcttccagtgggcgagcagacagtgaacgatcacca
ctgtctgggcagctaatggacctgggctacctgagcagcagtcacaggaactgcatggcc
tctgaccaggactgcagagctcagagcatgttggtggagcaaagtgagaaactgaggcag
ctgagtacgttttctcaccagctgctacagacccgcctcgtggatgcagccaaggccctg
aatgcggtgcacagccactgccttgacatctttattaaccaggcttttgacatgcagcgg
gacctgcagatcactcccaaacgcctagaatatactagaaaaaaggagaatgagttgtat
gagtcattgatgaatatcgccaaccgaaagcaagaggaaatgaaggatatgatcgttgag
acacttaacaccatgaaagaggagcttctggatgatgctgccaacatggagttcaaagat
gtcattgtccctgagaatggagagacagttgggaccagagagatcaaatcctgcatccga
cagatccaggagctcatcatctccagacttaaccaggcagtggccaacaagctcatcagc
tctgtggattacctacgggaaagcttcgtggggaccctggagcggtgtctacagagcctt
gaaaagtcacaggatgtctcagtgcacattaccagcaattatctcaaacagatcttaaat
gccgcttaccatgttgaagtcacttttcactcggggtcctcagttacacggatgctttgg
gaacaaatcaagcagatcatccagcgtatcacatgggtgaatccacccaccatcacccta
gagtggaagaggaaggtggcccaggaagccatcgacagcctcagtgcctccaaactggcc
aagagcatttgcagccagttccgtactcggctcaatagttcgcacgaggcttttgcggcc
tccttgaggcagctggaagctggccattcaggccgtctggagaaaactgaagatctgtgg
cttaaggttcgaaaagaccacgccccccgtctggcccgcctttcactagagagccggtct
ttacaggacgtcttgcttcaccgtaaacctaaattaggacaggaactaggccggggccaa
tatggtgtggtgtacctgtgtgacaactgggggggacacttcccttgtgccctcaagtca
gttgttcctccagacgagaagcactggaacgacctggcgttggagtttcactacatgagg
tctttgccaaagcatgagcggctggtagatctccatggctcagtcattgactacaactac
ggtggcggctccagcgttgctgtgttgctgattatggagcggctgcaccgggacctctac
acagggctgaaggctgggctttccctggagacacgtttgcaaatagctctggacgtggtg
gagggaatccgctttctgcacagccaggggcttgttcatcgggatatcaaactgaaaaat
gtgctgctggacaaacaaaaccgtgccaagatcactgacttaggattctgcaaaccagaa
gctatgatgtcaggcagcattgtgggaacaccgattcatatggcccctgaacttttcaca
ggaaagtatgataattctgtggacgtctatgcttttgggatccttttctggtatatctgc
tccggctctatcaagctccctgaggcatttgagaggtgtgcgagcaaagaccatctctgg
aataatgtgcgcagagggacccgtccggagcgtcttcctgtgtttgatgaggagtgctgg
cagttgatggaggcctgttgggatggtgacccctccaagaggcctctcttgggcattgtc
caacctatactccgaagcattatggaccggctctgcaagtgcgattctgagcggcctagc
agaggactagatgactctacctga

DBGET integrated database retrieval system