KEGG   Rattus norvegicus (rat): 304794
Entry
304794            CDS       T01003                                 

Gene name
Rbbp5
Definition
(RefSeq) RB binding protein 5, histone lysine methyltransferase complex subunit
  KO
K14961  COMPASS component SWD1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    304794 (Rbbp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    304794 (Rbbp5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     304794 (Rbbp5)
    COMPASS/SET1 complex (yeast)
     304794 (Rbbp5)
    MLL-HCF complex
     304794 (Rbbp5)
    MLL3/MLL4 complex
     304794 (Rbbp5)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Frtz
Other DBs
NCBI-GeneID: 304794
NCBI-ProteinID: NP_001100644
RGD: 1305532
Ensembl: ENSRNOG00000021289
UniProt: D3ZC01
Position
13q13
AA seq 538 aa
MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAK
IISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQ
NKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKT
DSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPE
PMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLD
VAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKS
EPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPP
DAVPTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSK
KKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEGSTKGKVQAGLSQPLAAGGAISELL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgaacctcgagttgctggagtcctttggacagaactatccagaggaagctgatggaact
ttggattgcatcagcatggccctgacttgcacctttaacaggtggggcacactgcttgct
gttggctgtaacgatggccgaattgttatttgggatttcttgacaagaggcattgctaaa
ataattagtgcacacatccatccagtctgttctttgtgttggagtcgagatggtcataag
ctcgtgagtgcttctacagataacatagtgtcacagtgggatgttctttctggagattgc
gaccagaggtttcgattcccttcacccatcttaaaagtccaatatcatcctcgagatcag
aacaaggttctcgtgtgtcccatgaaatctgctcctgtcatgttgaccctttcagattcc
aaacatgttgttctgccggtagacgatgactcggatttgaacgtggtggcatcttttgat
aggcgaggggaatatatttatacaggaaatgcaaaaggcaagatcttggtcctaaaaaca
gactctcaggatcttgttgcttccttcagagtaacaacgggaacaagcaataccacagcc
attaagtctattgagtttgcccgaaaggggagttgcttcctgattaacacagcagatcga
ataatcagagtttatgacggcagagagattttaacgtgtggacgggacggagagcctgag
cctatgcagaaactgcaggacttggtgaacaggactccatggaaaaaatgttgcttctct
ggggatggggagtacatagtggcaggctcagcgaggcagcatgcgctgtatatctgggaa
aagagcattggcaatctggtgaagatcttgcatgggaccagaggggagctcctgctggac
gtggcttggcatccagttcgacccatcatagcttctatttctagtggagtggtgtccatt
tgggcccaaaatcaagtagaaaattggagtgcatttgcaccagatttcaaagagttggat
gaaaatgtagaatatgaggaaagagaatcagaatttgatattgaggacgaagataagagt
gagcctgagcaaacaggggctgatgctgctgaagatgaggaagtggatgtcaccagtgtg
gatcccattgctgccttctgtagcagtgatgaagagctggaagattcaaaggctctattg
tatttacccattgcccctgaggtagaagaccctgaagagaatccgtatggccccccaccg
gatgcagtcccaacctccttgatggatgaaggggctagctcagagaagaagaggcagtct
tcagcagacgggtcccagcctccaaagaagaaacctaaaacgaccaatatagagctccaa
ggagtgccgaatgacgaagtccatccactgctgggtgtgaagggggatggcaaatccaag
aagaagcaagcaggccggcctaaaggatcaaaaggtaaagagaaagattctccatttaaa
ccgaaactctacaaaggggacagaggtttacctctggaaggatcaacgaagggtaaagtg
caggcgggactcagccagcccttggcagcaggaggagcaatctcagaactgctatga

DBGET integrated database retrieval system