KEGG   Rattus norvegicus (rat): 304802Help
Entry
304802            CDS       T01003                                 

Gene name
Optc
Definition
(RefSeq) opticin
  KO
K08128  opticin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    304802 (Optc)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    304802 (Optc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRRNT LRR_5
Motif
Other DBs
NCBI-GeneID: 304802
NCBI-ProteinID: NP_001100646
RGD: 1304916
Ensembl: ENSRNOG00000003059
Vega: OTTRNOG00000000637
UniProt: D3ZWK1
Position
13q13
AA seq 361 aa AA seqDB search
MGNLIRHMDPWANYLSSPWPINEGVSSCPLVWQAVIIPIRVFVSLEAAGPDGTKTSKRMY
VEWIQPFPLLPFPQNLMKFLTFLSLLTLVLQEAGTASLLGEREREEKSPEEADTYASLHV
GNYSLSLEDYSEVIDLSSYEELADYGDQIPEAKTSSPTLPTRTSPTSPVVPRTLPSRLTM
AGPTTTGLLNSQSSHGLPTCLVCVCLGSSVYCDDANLENIPPLPQMTTYLYARFNHISHI
QAGDFKGMTKLRRIDLSSNSISSIHNDALRLLPALQDLILPENQLAALPVLPSGLEFLDV
RLNRLQSSGIQPEAFVTLEKLQFLYLADNLLDSIPGPLPLSLRSLHLQRVISVLEPGLSD
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatctaattagacacatggatccctgggccaactacttgtcctctccctggcca
ataaatgagggagtgtctagctgtcccctagtctggcaggcagtcatcatccccatcaga
gtctttgtctccctggaagctgctggaccagacggaaccaaaacttctaaaaggatgtac
gtcgaatggattcagccgttcccactcctacccttccctcagaacctcatgaagttcctg
actttcctgagtctgttgaccctggtgctgcaggaggcagggacagcgtctctcctagga
gagagagaaagagaagagaagagccctgaggaagctgacacttatgcatccctgcatgtg
gggaactatagcctgagcctagaggactacagtgaagtcattgatctgagcagctatgag
gaacttgcagactatggggaccagatccctgaggccaaaacaagcagtccgactcttcca
acaagaactagtcccactagccctgtggttccaaggacattgccatcacgcctcacaatg
gccggacctaccaccactggactactgaactcccagagcagtcacggcctgcctacctgc
ctggtctgcgtgtgccttggctcttctgtgtactgtgatgatgcgaacctcgagaacatt
cctcctcttccccagatgaccacctacctctacgctcgcttcaaccacatcagccacatc
caggctggagacttcaaagggatgacaaaactgaggaggatcgatctctccagcaactcc
atctcctccatccacaacgatgccctccgcctgctgcctgccctgcaggatctgatcctt
ccagagaaccagctggcagccctgcctgtgctgcccagtggcctcgagttcctggacgtc
cgcctgaatcggctgcagagctcagggatacagcctgaggccttcgtgacgctggagaag
ctgcagtttctctacctggcggacaacctgctggattccatccctgggcctttgcccctc
agcctgcgctccctgcacctgcagagagtcatcagtgtgctggagcctggtctttctgac
tggtag

DBGET integrated database retrieval system