KEGG   Rattus norvegicus (rat): 304815
Entry
304815            CDS       T01003                                 

Gene name
Elf3
Definition
(RefSeq) E74-like factor 3
  KO
K09429  E74-like factor 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    304815 (Elf3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    304815 (Elf3)
SSDB
Motif
Pfam: Ets SAM_PNT AT_hook
Other DBs
NCBI-GeneID: 304815
NCBI-ProteinID: NP_001019939
RGD: 1310687
Ensembl: ENSRNOG00000006330
UniProt: Q4V7E1
Position
13q13
AA seq 395 aa
MAATCEISNVFSNYFNAMYSSEDPTLAPAPLTTFGTEDFVLTLNNQHMSPEGPVGCVGPQ
TRSQRDRTEPPAVLHLAEKASWTGERPQFWSKTQVLDWISYQVEKNKYDASSIDFSRCDM
DGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMTFQEGLGDS
GPFDQGSPFAQELLDDGRQASPYYGSSYGPGAPSPGSSDFSTSGTDTPQSSHSSDSGGSD
VDLDLTDSKVFPRDGFPDYKKGEPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLW
EFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYY
YKREILERVDGRRLVYKFGKNSSGWKEEEVGESQN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctgccacctgtgagatcagcaacgtttttagcaactacttcaacgccatgtacagt
tcagaagaccccaccctggctcctgctcctctgactacttttggcactgaagactttgtg
ttgaccctgaacaaccaacacatgtccccagaaggtccagtaggttgtgtaggacctcag
acaagatcccaaagggacagaactgagcctccggctgtactccaccttgcagagaaggca
agctggaccggagagcggccccagttctggtcgaagacccaggtactggattggatcagc
taccaagtggagaagaacaagtatgatgccagttccattgacttctcgcgctgcgacatg
gacggcgccaccctctgcaactgtgcgctggaggagctgcgactagtctttggccctctg
ggagaccaactccatgcccagcttcgggacctcacctccagctcttctgatgaacttagt
tggatcatcgagctgctggagaaggacggcatgaccttccaagagggcctaggagactcg
ggtccctttgaccagggaagcccttttgcccaggagctactggatgatggccgtcaggcc
agcccctactacggcagttcctatggccctggagcgccctctccaggtagctctgatttc
tccacttcagggaccgatactccccagagttcccactcctctgactccggtggaagtgat
gtggacctggacctcaccgatagcaaggtcttccctagagatggctttcctgactataag
aagggagaacccaagcatggaaagaggaaacgggggcgtccccgaaagctgagcaaagaa
tactgggactgtctggagggcaagaagagcaagcatgcccccagaggtactcacctgtgg
gagttcatccgggacattcttatccaccctgagctcaacgaaggcctcatgaaatgggag
aaccggcacgagggcgttttcaagtttcttcgttcagaggctgtggcccaactatggggc
caaaagaagaagaatagcaacatgacctatgagaagctgagccgggccatgaggtactac
tacaaacgggagatcctggaacgggtggatggccgtcggctcgtctacaagtttggcaag
aactccagtggctggaaggaagaagaggttggagagagtcagaattaa

DBGET integrated database retrieval system