KEGG   Rattus norvegicus (rat): 304817
Entry
304817            CDS       T01003                                 

Gene name
Ipo9
Definition
(RefSeq) importin 9
  KO
K20224  importin-9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    304817 (Ipo9)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    304817 (Ipo9)
  Pre-60S particles
    304817 (Ipo9)
SSDB
Motif
Pfam: IBN_N Xpo1 Ribosomal_60s
Other DBs
NCBI-GeneID: 304817
NCBI-ProteinID: NP_001100650
RGD: 1310537
Ensembl: ENSRNOG00000007418
UniProt: D4A857
Position
13q13
AA seq 1041 aa
MAAAAAAGAASGLPGPVAQGLKEALVDTLTGILSPVQEVRAAAEEQIKVLEVTEEFGVHL
AELTVDPQGALAIRQLASVILKQYVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRES
ISKVRSSVAYAVSAIAHWDWPEAWPQLFNLLMEMLVSGDLNAVHGAMRVLTEFTREVTDT
QMPLVAPVILPEMYKIFTMAEVYGIRTRSRAVEIFTTCAHMICNMEELEKGAAKVLIFPV
VQQFTEAFVQALQMPDGPTSDSGFKMEVLKAVTALVKNFPKHMVSSMQQILPIVWNTLTE
SAAFYVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFKSTVKKALPEL
IYYIILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAVA
LATAATRHLQEAEQTKASGTEHWWKIHEACMLALGSVKSIITDSVKNGRIHFDMHGFLTN
VILADLNLSASPFLLGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRA
IWGYCDQLKVSESTHVLQPFLPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTAS
VESKICPFTIAIFLKYSNDPVVASLAQDIFKELSQIEACQGPMQMRLIPTLVSIMQAPAD
KIPAGLCATAIDILTTVVRNTKPPLSQLLICQAFPAVAQCTLHTDDNATMQNGGECLRAY
VSVTLEQVAQWHDEQGHNGLWYVMQVVSQLLDPRTSEFTAAFVGRLVSTLISKAGRELGE
NLDQILRAILSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFVM
AEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSK
SAKNPERWTNIPLLVKILKLIINELSNVMEANAARQATPAEWNQDDSNDMWEDQEEEEEE
EEDGLAGQLLSDILATSKYEEDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPC
YIMFSCHLNDTERRVLQTIGI
NT seq 3126 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcagctggtgcggcttctgggctgccgggtccagtggcacaggga
ttgaaggaggcgttggtggataccctcaccgggatcctgtccccggtgcaggaggtgcgg
gcggctgcagaggagcagattaaggtgctggaggtgacagaggaatttggtgttcacctg
gcagagctgactgtagatcctcagggggcactggccatccgtcagctggcgtcagtcatc
ttgaaacagtatgtggaaactcactggtgtgcccaatcagagaagttcagacctccggaa
actacagaaagggcaaaaattgttatccgagagctattacccaacgggttgagagaatca
ataagcaaagtgcgctccagtgtggcctatgctgtgtccgccattgcccactgggactgg
cccgaagcctggccccagctcttcaacctgcttatggagatgttggtgagcggagactta
aatgctgtccatggagccatgcgtgtgttgacagagtttactcgggaagtgacagacaca
cagatgccacttgttgctcccgtcattctcccagagatgtataagatattcaccatggcc
gaggtgtatggtattcgaacgcgttcccgggcagtggagatttttactacttgtgctcat
atgatctgtaacatggaggaactggaaaagggtgcagccaaagtcctgatcttccccgtg
gtgcagcagttcacagaggcctttgttcaggcgctgcagatgccagacggccccacgtcg
gacagtggctttaagatggaggttctgaaggcagtgacagccttggtgaaaaacttccca
aagcacatggtatcctccatgcaacagatcctgcccattgtctggaacactctgactgaa
agcgctgccttttatgtgaggacagaagtgaattacacggaagaagtggaagaccctgtg
gactctgacggagaagtcctgggctttgaaaacctcgtctttagcatttttgaatttgtc
catgcactactggaaaacagcaaattcaaaagcaccgttaagaaagcgttgcctgagctc
atttactatatcatcctgtacatgcagatcaccgaggagcagattaaagtgtggacggct
aacccacagcagtttgtagaagacgaggatgacgacacgttctcctacactgttagaatt
gcagctcaggacctgttgctggctgtggccacagatttccagaatgagagtgcagtggcc
ctggctactgcagccactcggcacttacaagaagctgagcagacgaaagccagtggcact
gagcactggtggaagatccacgaagcctgcatgcttgctctaggctctgtgaaatctatc
atcactgacagtgtgaaaaatggcaggatccattttgatatgcatgggttcctgactaac
gtcattcttgcagacctcaacctgtcagcatctcctttcctcttgggccgggcactgtgg
gctgccagtcgcttcactgtcgctatgtcccctgaactgattcagcagttcctacaggca
acagttagtggtcttcatgagacacagcctccgtcagttcgcatctctgccgtgagagcc
atctggggttattgtgatcagctgaaagtctcagagagtacgcatgtgcttcagcccttc
ctccccagcatcctggatggcctaattcacctagcagcccagttcagctccgaggtcctc
aacctggtgatggagaccctgtgcatcgtttgtactgttgacccagagtttacagcaagt
gtggaaagcaaaatctgccccttcaccatcgccattttcctaaagtacagtaatgaccct
gtggttgcctcgctggctcaggacatcttcaaggaactgtcccagattgaagcctgccaa
ggtccaatgcagatgaggctgattcccactctggtcagcataatgcaggccccagcagac
aagatccctgcagggctctgtgcgacagccattgatatcttgactacagtagttcgaaat
acaaagcctcccctttcccagctcctcatctgtcaagctttccctgctgtggcacagtgc
acccttcacacggatgataatgccaccatgcagaatggtggtgagtgtttgcgggcctat
gtgtcagtgacactggaacaggtagcccagtggcatgatgagcaaggccacaatggacta
tggtacgtgatgcaagtagtgagccagctccttgacccacgaacctcagagttcactgca
gcctttgtgggccgcctggtctccaccctcatctccaaggcagggcgggagcttggggag
aatctggatcagattcttcgtgccatcctcagtaagatgcagcaggcagagacactcagt
gtcatgcagtcgctcatcatggtgtttgctcatctggtgcacactcagctggaacctctg
ttggagttcctgtgtagcctcccaggaccaactgggaaacctgccctggagtttgtgatg
gctgagtggacgagtcggcagcacctgttctatggacagtatgaaggcaaagttagctct
gtggcactatgtaaactgcttcagcatggcatcaatgcagatgacaagcggctacaagac
attcgtgtgaagggagaagaaatctacagcatggatgagggcatccgcacccgctctaag
tcagccaaaaaccctgagcgctggacaaacattcctttgttggtcaagatcctaaagctg
attatcaatgagctttccaacgtcatggaggccaacgctgctcgccaggccactcccgcc
gagtggaaccaagatgattccaatgatatgtgggaggaccaggaggaagaggaagaggag
gaagaggatggtttagctggccagcttttatctgacattcttgctacaagtaaatatgag
gaggattactatgaagacgatgaagaagatgaccccgatgccctgaaggaccctctctac
cagatcgatctgcaggcatatctcacagacttcctttgccagtttgctcagcagccctgt
tacataatgttttcatgccaccttaacgacaccgagaggcgggtcctacagactatcggc
atctaa

DBGET integrated database retrieval system