KEGG   Rattus norvegicus (rat): 304827
Entry
304827            CDS       T01003                                 

Gene name
Kcnt2, Slick
Definition
(RefSeq) potassium sodium-activated channel subfamily T member 2
  KO
K04947  potassium channel subfamily T member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    304827 (Kcnt2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   304827 (Kcnt2)
SSDB
Motif
Pfam: BK_channel_a Ion_trans_2 Anophelin Ion_trans TrkA_N
Other DBs
NCBI-GeneID: 304827
NCBI-ProteinID: NP_942057
RGD: 735074
Ensembl: ENSRNOG00000013312
UniProt: Q6UVM4
Position
13q21
AA seq 1142 aa
MVDLESEVPPLPPRYRFRDLLLGDQGWQNDDRVQVEFYMNENTFKERLKLFFIKNQRSSL
RIRLFNFSLKLLSCLLYIIRVLLEKPSQGNDWSHIFWVNRSLPLWGLQVSVALISLFETI
LLGYLSYKGNIWEQILRVPFILEIINAVPFIISIFWPTLRNLFVPVFLNCWLAKHALENM
INDLHRAIQRTQSAMFNQVLILISTLLCLIFTCICGIQHLERIGKKLNLFDSLYFCIVTF
STVGFGDVTPETWSSKLFVVAMICVALVVLPIQFEQLAYLWMERQKSGGNYSRHRAQTEK
HVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPMWSQRVIYL
QGSALKDQDLLRAKMDNAEACFILSSRCEVDRTSSDHQTILRAWAVKDFAPNCPLYVQIL
KPENKFHIKFADHVVCEEEFKYAMLALNCICPATSTLITLLVHTSRGQCVCLCCREGQQS
PEQWQKTYGRCSGNEVYHIVLEESTFFAEYEGKSFTYASFHAHKKFGVCLVGVRREDNKN
ILLNPGPRYIMNASDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIAS
MGTVAIDLQDTSCRAASGPTLALPSEGGKELRRPSIAPVLEVADTSSIQTCDLLSDQSED
ETTPDEETSSNLEYAKGYPPYSPYIGSSPTFCHLLQEKVPFCCLRLDKSCQHNYYEDAKA
YGFKNKLIIVAAETAGNGLYNFIVPLRAYYRPKKELNPIVLLLDNPPDMHFLDAICWFPM
VYYMVGSIDNLDDLLRCGVTFAANMVVVDKESTMSAEEDYMADAKTIVNVQTLFRLFSSL
SIITELTHPANMRFMQFRAKDCYSLALSKLEKKERERGSNLAFMFRLPFAAGRVFSISML
DTLLYQSFVKDYMISITRLLLGLDTIPGSGFLCSMKITEDDLWIRTYARLYQKLCSSTGD
VPIGIYRTESQKLTTSESQISISVEEWEDTKDVKDPGHHRSIHRNSTSSDQSDHPLLRRK
SMQWARRLSRKGPKHSGKTAEKITQQRLNLYRRSERQELAELVKNRMKHLGLSTVGYDEM
NDHQSTLSYILINPSPDTRLELNDVVYLIRPDPLSYLPNSEPSRKNSICNAAVQDSREET
QL
NT seq 3429 nt   +upstreamnt  +downstreamnt
atggttgatttggagagcgaagtaccccctctgcctcccaggtacagattccgtgatttg
ctgctaggggaccaaggctggcagaatgatgacagggttcaagtcgaattctacatgaat
gaaaacacatttaaagagagattaaagttgtttttcataaaaaaccagcgatcaagtcta
agaatccgcttgttcaacttttccctcaaattgttaagctgtttgttatacattatccgt
gtgttgcttgagaaaccttcacagggaaatgattggtctcacatattttgggttaacaga
agcctgcctttatggggtttacaggtctcggtggcattgataagtctatttgaaacaata
ctccttggatatctcagttataaggggaatatctgggagcagattttacgagttccattc
atcttggaaataatcaatgcagttcccttcatcatctcaatattctggcctacgttaaga
aatctctttgttccagtttttctaaattgttggcttgccaaacatgccttggaaaatatg
attaatgatcttcatcgagccattcagcgtacacagtctgcaatgtttaatcaagttctg
attttgatatctactttactatgccttatcttcacttgcatttgtggaattcagcatctg
gaacgaattggaaagaaactcaatctctttgactccctgtatttctgcattgtgacattt
tctactgtgggctttggggatgttactcctgaaacatggtcctccaagctttttgttgtt
gctatgatctgcgttgctcttgtagttctccccatacagtttgaacagctggcctatttg
tggatggagagacaaaagtcgggaggaaactatagtcgacacagagctcagactgagaag
catgttgttctgtgtgtcagctcattgaagattgacttgcttatggattttttgaatgaa
ttctatgcacatccaagactgcaggattattatgtggtgattttgtgtcccacggagatg
gatgtgcaagttcggagagtgctacagattccaatgtggtcccagagagtgatctacctt
caaggctctgcccttaaagaccaggatctcctgagagcaaagatggacaatgctgaggcc
tgtttcattttgagtagccgctgtgaagtcgatagaacatcatctgatcaccagacaatt
ttgagagcatgggctgtaaaagattttgccccaaattgtcctctgtatgttcagatatta
aaaccagaaaataaattccacatcaaatttgcagatcatgttgtttgtgaagaagagttt
aagtacgccatgttagctttaaactgtatatgcccagcaacatctacacttattacacta
ctggttcatacctctagagggcagtgtgtgtgcttgtgttgcagagaagggcagcagtca
cctgaacagtggcagaagacgtatgggaggtgctcaggaaatgaagtctaccacatcgtt
ctggaagaaagtacattttttgctgaatatgaagggaagagttttacctatgcttctttc
catgcacacaaaaagtttggtgtctgcttggttggtgttaggagggaggataataaaaac
attttgctgaatccaggtcctcgatacattatgaatgcttcagacatatgtttttatatt
aatattaccaaagaagaaaattcagcatttaagaatcaagaccaacagagaaaaagtaat
gtgtcaaggtcattttatcatgggccttccagattgcctgtccacagtatcattgccagc
atgggtactgtggctatagacttacaagacacaagctgtagagcagcaagtggccctaca
ctggctcttccttcagagggaggcaaggaactaagaagacctagcattgctcctgtttta
gaggtagcagatacatcatcaattcaaacctgcgatcttctaagtgaccagtcagaagat
gaaactacaccagatgaagaaacatcttcaaatttagagtatgccaaaggctacccacct
tattctccatacataggaagttcacctactttttgtcatctacttcaagaaaaagtgccc
ttttgctgcctaagattagacaagagttgccagcataactactatgaggatgcaaaagcc
tatggattcaaaaataaactaattatagttgcagctgaaacggctgggaacggattatat
aattttattgtacctctcagggcatattatagaccaaagaaagaattaaatcccatagtt
cttctattggataatccgccagatatgcattttctggatgcaatctgttggtttccaatg
gtttactacatggtgggctctattgacaacctagatgatttgctcaggtgtggagtgacc
ttcgctgccaacatggtggttgtggacaaagaaagcaccatgagtgcagaggaagactac
atggcagatgccaagacgattgtgaatgtgcagactcttttcaggttgttttcgagtctc
agtattatcactgagcttactcatccagcaaatatgagattcatgcaattcagagccaag
gactgttactctcttgcactttcaaaactggaaaagaaagagcgagaacgaggttctaac
ctggccttcatgttccgactgcctttcgctgcggggagagtgttcagcatcagtatgctg
gacacgctgctttatcagtcatttgtgaaagattatatgatttctatcaccagacttctt
ttgggactggacaccataccaggatcggggtttctttgttctatgaaaattactgaagat
gacttgtggatcagaacgtatgccagactctatcagaagctgtgttcttctactggagat
gttcccattgggatctacagaacagaatctcagaagctaactacatctgagtctcaaata
tccatcagtgtggaagagtgggaagacaccaaagatgtcaaagacccagggcaccaccgc
agcattcaccgcaactcaacctctagcgaccagtcagaccaccccttgctgcggaggaag
agcatgcagtgggcccggaggctgagcagaaaagggccaaagcactctggtaaaactgca
gaaaagataacccagcaacgactgaatctctacaggaggtcggaaagacaggagcttgct
gaacttgtgaaaaacagaatgaaacacctgggcctctctacggtgggctacgatgaaatg
aatgatcatcagagcaccctttcctacatcctgattaatccatctccagacaccaggctt
gagctgaatgatgttgtatatttgatccgaccagatccactgtcctaccttccgaacagt
gaacccagtaggaaaaacagcatctgcaatgccgctgttcaagattctcgggaggaaaca
caactctga

DBGET integrated database retrieval system