KEGG   Rattus norvegicus (rat): 304832Help
Entry
304832            CDS       T01003                                 

Gene name
Cdc73, Hrpt2
Definition
(RefSeq) cell division cycle 73
  KO
K15175  parafibromin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    304832 (Cdc73)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    PAF1 complex
     304832 (Cdc73)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC73_N CDC73_C PemK_toxin
Motif
Other DBs
NCBI-GeneID: 304832
NCBI-ProteinID: NP_001019940
RGD: 1311766
Ensembl: ENSRNOG00000003258
UniProt: Q4V8C8
Position
13q21
AA seq 531 aa AA seqDB search
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI
LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR
STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMLVE
KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS
TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKG
KEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTP
IIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS
VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKY
DEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgctcagcgtcctgcgacagtacaacatccagaagaaggagattgtggtc
aagggggatgaagtgatcttcggggagttctcctggcccaagaatgtgaagaccaactat
gtagtttgggggaccggaaaggaaggccaacccagagaatactacacattggattctatc
ctatttctccttaataatgtgcacctttcgcatcctgtttatgtccgacgtgcagctact
gaaaatattcctgtggttagaagacctgacagaaaggatctccttggatatctcaatggg
gaagcatcaacatcagcaagcatagacaggagtgcccccctggaaataggtcttcagcgg
tctactcaagtcaaaagagctgcagatgaagttttagcagaagcaaagaaaccacgaatt
gaggatgaagagtgtgtgcgccttgataaagagagattggcagcccgtttggaaggccat
aaagaaggaatcgtgcagactgaacagattaggtctttatctgaagccatgttagtggaa
aaaattgctgcaatcaaagccaaaattatggctaagaaaagatctactatcaagaccgat
ctagatgatgatataactgcccttaagcagaggagttttgtggatgctgaggtagatgtg
accagagatattgtcagcagagagagagtatggcggacaagaacaactatcttacagagc
acaggaaagaatttttcaaagaatattttcgcaattcttcaatcagtaaaagccagagaa
gaagggcgtgcccccgaacaacggccagctccaaatgcagcccctgtggatcctacattg
cgtacaaaacagcctattccagctgcctacaacagatatgaccaagaaagattcaaaggc
aaagaagaaacggaaggttttaagatcgatactatgggtacctaccatggcatgacgctg
aaatctgtcacggaaggtgcatctgcccgtaagactcaaactcctgcagcccagcctgta
cctagaccagtgtctcaagcaagacctcccccaaatcagaagaaagggtctcgaacaccc
atcattattattcctgcagctaccacttctttaataaccatgcttaatgcaaaagacctt
ctacaggatctgaaatttgtcccatcagatgaaaagaagaaacagggatgtcaacgagaa
aatgaaacactaatacagagaagaaaagaccagatgcaacctgggggcacagcaattagt
gtcacagtcccttacagagtagtagaccagcctctgaagcttatgcctcaagactgggat
cgagtcgtagctgtttttgtacaaggtcctgcttggcagttcaaaggttggccatggctt
ctacctgatggatcaccagttgacatatttgcaaaaattaaagccttccatctcaagtat
gatgaagttcgtctagatccaaatgttcaaaaatgggatgtaacagtattagaactcagc
tatcataaacgtcatttggatagaccagttttcttacgtttctgggaaacattggataga
tacatggtaaagcacaaatcccacttgagattctga

DBGET integrated database retrieval system