KEGG   Rattus norvegicus (rat): 304850Help
Entry
304850            CDS       T01003                                 

Gene name
Rnf2
Definition
(RefSeq) ring finger protein 2
  KO
K10695  E3 ubiquitin-protein ligase RNF1/2 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    304850 (Rnf2)
   03036 Chromosome and associated proteins [BR:rno03036]
    304850 (Rnf2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     304850 (Rnf2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    304850 (Rnf2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     304850 (Rnf2)
    AUTS2-polycomb complex
     304850 (Rnf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 RAWUL zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-Nse zf-RING_4 zf-RING_6 zf-rbx1 zf-C3HC4_5 zf-UDP Prok-RING_4 zf-ANAPC11 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 304850
NCBI-ProteinID: NP_001020838
RGD: 1305491
Ensembl: ENSRNOG00000002454
UniProt: Q4KLY4 M5AJY0
Position
13q21
AA seq 308 aa AA seqDB search
MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKN
TMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY
EAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKD
DSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVSICQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggctgtgcagacaaatggaactcaaccattaagcaagacatgggagctcagt
ttgtacgaattacaacggacacctcaggaggcaataacagatggcttggaaatcgtggtt
tcacctagaagtcttcacagtgagttgatgtgcccaatttgtttggatatgttgaagaac
accatgaccacaaaggagtgcttacatcgcttttgtgcggattgcattatcacggccctc
agaagtggcaacaaagaatgccctacctgtcggaaaaaactggtttctaaaagatcacta
aggccagatccaaattttgatgcactcatcagcaagatttatccgagccgtgatgagtat
gaagctcatcaagagagagtattagctaggatcaacaagcacaacaatcagcaggccctc
agccacagcattgaggaggggctgaagatacaggccatgaacagattacagcgaggcaaa
aagcagcagattgaaaatggcagcggagcagaagataatggtgacagttcccattgcagt
aatgcgtccacacacagcaatcaggaagccggccccagtaacaaacggaccaagacctca
gatgactctgggcttgaactcgacaacaacaatgcagcagtggcaatcgatccagtgatg
gatggtgccagtgagattgagttggtattcaggccccacccaactcttatggagaaggac
gacagcgcacagaccagatacataaagacttcaggcaatgccactgttgatcacttatcc
aagtacctggccgtgaggttagctttagaagagcttcgaagcaaaggagagtcaaaccag
atgaacctggatacagccagtgaaaagcagtacaccatttacatagctacagccagtggc
cagttcactgtgagtatttgtcagtga

DBGET integrated database retrieval system