KEGG   Rattus norvegicus (rat): 304917
Entry
304917            CDS       T01003                                 

Gene name
Serpinc1
Definition
(RefSeq) serpin family C member 1
  KO
K03911  antithrombin III
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    304917 (Serpinc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    304917 (Serpinc1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    304917 (Serpinc1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    304917 (Serpinc1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   304917 (Serpinc1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   304917 (Serpinc1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   304917 (Serpinc1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 304917
NCBI-ProteinID: NP_001012027
RGD: 1307404
Ensembl: ENSRNOG00000002783
Vega: OTTRNOG00000000179
UniProt: Q5M7T5
Position
13q22
AA seq 465 aa
MYSPGIGSAVAGERKLCLLSLLLIGALGCAVCHGNPVDDICIAKPRDIPVNPMCIYRSPA
KKATEEDVLEQKVPEATNRRVWELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAF
AMTKLGACNNTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSNLVSANRLF
GDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAI
DELTALVLVNTIYFKGLWKSKFSPENTRKEPFHKVDGQSCLVPMMYQEGKFKYRRVGEGT
QVLEMPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDELSEVMLVVHVPRFRIED
SFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVSDAFHKAFLEVNEEGSEAAASTS
VVITGRSLNPSRVTFKANRPFLVLIREVALNTIIFMGRVSNPCVN
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtattccccgggaataggaagtgcggttgctggagagaggaagctttgtctcctctct
ctgctactcattggtgccttgggctgtgctgtctgtcatggaaaccctgtggacgacatc
tgcatagcgaagccccgagacatccccgtgaaccccatgtgcatttaccgctcccctgcg
aagaaggccacggaggaggatgtcctagagcagaaggttccggaagccaccaaccggcgg
gtctgggaactgtccaaggccaattctcgatttgccactaacttctatcagcacctggca
gactccaagaacgacaacgacaacattttcctgtcacccttgagcatctccacggcgttt
gctatgaccaagctgggtgcttgtaataacaccctcaagcagctgatggaggtttttaaa
tttgataccatctccgagaagacatccgaccagatccacttcttctttgccaaactgaac
tgccgactctatcgaaaagccaacaagtcctctaacttggtgtcagccaaccgccttttt
ggagacaaatcccttaccttcaatgagagctatcaagacgttagtgagattgtctatgga
gccaagcttcagcccctggacttcaaggagaatccggagcaatccagagtgaccatcaac
aactgggtagctaataagactgaaggccgcatcaaagacgtcatcccccaaggagccatt
gatgagctcactgccctggtgctggttaacaccatttacttcaagggcctgtggaagtca
aagttcagccctgagaacacaaggaaggaaccattccacaaagttgatgggcagtcatgc
ctggtgcccatgatgtaccaggaaggcaaattcaaatacaggcgtgtgggagagggtacc
caggtgctagagatgcccttcaagggggacgacatcaccatggtgctcatcctgcccaag
cctgagaagagcctggctaaggtggagcaggaactcaccccggagctgctgcaggagtgg
ctggatgagctgtcggaggtcatgcttgtggtccacgtgccccgcttccgcatcgaggac
agcttcagtctgaaggagcagctgcaagacatgggccttgttgatctcttcagccctgag
aagtcccaactcccagggatcattgctgaaggcagggacgacctctttgtctccgatgca
ttccacaaagcgtttcttgaggtaaatgaggaaggcagtgaagcagcagcgagtacttct
gtcgtgattactggccggtcactgaaccccagtagggtgaccttcaaggccaacaggccc
ttcctggttcttataagggaagtcgcactgaacactattatattcatggggagagtgtct
aatccttgtgtgaactaa

DBGET integrated database retrieval system