KEGG   Rattus norvegicus (rat): 304951Help
Entry
304951            CDS       T01003                                 

Gene name
Nuf2, Cdca1
Definition
(RefSeq) NUF2, NDC80 kinetochore complex component
  KO
K11548  kinetochore protein Nuf2
Organism
rno  Rattus norvegicus (rat)
Brite
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      304951 (Nuf2)
    NMS complex
      304951 (Nuf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nuf2 COG5 BST2 Cytochrom_B562 ATG16 Golgin_A5
Motif
Other DBs
NCBI-GeneID: 304951
NCBI-ProteinID: NP_001012028
RGD: 1307952
Ensembl: ENSRNOG00000002711
UniProt: Q6AYL9
Position
13q24
AA seq 464 aa AA seqDB search
METLSFPRYNIAEIVVHIRNKLLTGADGKNLSKSDFLPNPKPEVLYMIYMRALQLVYGVR
LEHFYMMPVNIEVMYPHIMEGFLPVSNLFFHLDSFMPICRVNDFEIADILYPKANRTSRF
LSGIINFIHFRETCLEKYEEFLLQNKSSVDKIQQLSNAHQEALMKLEKLNSVPVEEQEEF
KQLKDDIQELQHLLNQDFRQKTTLLQERYTKMKSDFSEKTKHVNELKLSVVSLKEVQDSL
KSKIVDSPEKLKNYKEKMKDTVQKLRSAREEVMEKYDIYRDSVDCLPSCQLEVQLYQKKS
QDLADNREKLSSILKESLNLEGQIDSDSSELKKLKTEENSLIRLMTLKKERLATMQFKIN
KKQEDVKQYKRTMIEDCNKVQEKRDAVCEQVTAINQDIHKIKSGIQQLRDAEKREKLKSQ
EILVDLKSALEKYHEGIEKTTEECCTRIGGKTAELKRRMFKMPP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaaactctgtccttccccagatacaacatagctgagattgtagttcatattcgcaat
aaactgttaactggagcggatggcaaaaacctctccaagagcgattttcttccaaacccg
aagcctgaagtcctgtacatgatttacatgagagccttacagttagtgtatggggtccgg
ctggagcatttctacatgatgccggtgaacatagaagtcatgtatccacatataatggag
ggcttcttaccggtcagcaatttgttcttccacctggactcgtttatgcccatttgccgg
gtgaatgactttgagatcgccgatattctttatccaaaagcaaaccggacaagtcgtttt
ttaagtggcattatcaactttattcacttcagagaaacatgcctggagaagtatgaagaa
tttcttttgcaaaataaatcctctgtggacaaaatacagcagttaagcaatgcacaccag
gaagcattgatgaaactggaaaaactcaattcggttcccgtggaggagcaggaagagttc
aaacagctgaaggatgacatccaggagctgcagcacttgctgaatcaagacttcagacag
aaaacgacactgctgcaggagagatataccaaaatgaaatcagatttttcagagaaaacc
aagcatgttaatgagctaaagttgtcagtagtttctttgaaagaagttcaagacagtttg
aaaagcaaaattgtggattctccagagaagctgaagaactataaagagaagatgaaggac
accgtccagaagctccgcagtgccagggaagaagtgatggaaaagtatgatatctataga
gattctgtggattgcttgccttcctgtcagctggaggtgcagttatatcaaaagaaatca
caggaccttgcagataatagggagaaactaagcagtatcttaaaggagagcctgaacctg
gagggccagattgatagtgattcatcagaactaaagaaactgaagactgaagagaactcc
ctcataagactgatgactctaaagaaggagagacttgctaccatgcagttcaaaataaac
aagaagcaggaggatgtgaaacagtacaagcggaccatgattgaagattgcaataaagtt
caagaaaaaagagatgctgtctgcgagcaagtaaccgccattaatcaagacatccacaag
attaaatctgggattcagcagctaagagacgccgaaaaacgggagaaactgaagtctcag
gaaatcttggtagacttgaaaagtgctttggagaagtaccatgagggcatcgagaagacg
acggaggagtgctgcactagaataggagggaagactgccgagctgaagaggaggatgttc
aaaatgccgccctga

DBGET integrated database retrieval system