KEGG   Rattus norvegicus (rat): 304960
Entry
304960            CDS       T01003                                 

Gene name
Olfml2b
Definition
(RefSeq) olfactomedin-like 2B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: OLF Noelin-1 HMMR_C Med13_C Zw10
Other DBs
NCBI-GeneID: 304960
NCBI-ProteinID: NP_001100665
RGD: 1309257
Ensembl: ENSRNOG00000003018
UniProt: D4A0J7
Position
13q24
AA seq 746 aa
MAYPLPLVLCFALVVARVWGSSTPPTGTSEPPDVQTVAPTEDDVLQNEADNQENVLSQLL
GDYDKVKAVSEGSDCQCKCVVRPLGRDACQRINEGASRKEDFYTVETITSGSSCKCACVA
PPSAVNPCEGDFRLQKLREADSRDLKLSTIIDMLEGAFYGLDLLKLHSVTTKLVGRVDKL
EEEVSKNLTKENEQIKEDVEEIRTELNKRGKENCSDNILGNMPDIRSALQRDAAAAYAHP
EYEERFLQEETVSQQINSIELLRTQPLAPPTVMKPRQPSQRQVHLRGRLASKPTVIRGIT
YYKAKVSEEENDIEDQHDELFSGDSGVDLLIEDQLLRQEDLLMSATRRPATTRHAAAVST
DASVQATALSSEPAQASASAPSLVDPASQAPDRQLLASPQTTTVSPETMGVMPSTQVSPT
TVAHTAIQPPPAMIPGDIFVEALHLVPMSPDTVGTDMAEEEGTARQEATSASPILSPEEE
DDIRNVIGRCKDTLSTITGPTTQNTYGRNEGAWMKDPLAKDDRIYVTNYYYGNTLVEFRN
LENFKQGRWSNSYKLPYSWIGTGHVVYNGAFYYNRAFTRNIIKYDLKQRYVAAWAMLHDV
AYEETTPWRWQGHSDVDFAVDENGLWLIYPALDDEGFSQEVIVLSKLNAVDLSTQKETTW
RTGLRRNFYGNCFVICGVLYAVDSYNQRNANISYAFDTHTNTQIVPRLLFENEYSYTTQI
DYNPKDRLLYAWDNGHQVTYHVIFAY
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggcctatcctctgccattggttctctgctttgctttggtggtggcacgggtctggggg
tccagtacacctcccacagggacaagtgagccccccgatgtgcaaacagtggcgcccacg
gaggatgacgttctgcaaaacgaggcggacaaccaggagaacgttttatctcagctgctg
ggagactatgacaaggtcaaggctgtgtctgagggctctgactgtcagtgcaagtgtgtg
gtgagaccgctgggccgagatgcgtgtcagaggatcaacgagggggcttccaggaaggaa
gacttctacactgtggaaacaatcacctcaggctcatcctgtaaatgtgcttgtgttgcc
cctccctctgccgtcaatccctgtgagggagacttcaggctccagaagcttcgggaggct
gatagccgggatttgaagctttctacaattatagacatgctggaaggtgctttctacggc
ctggatctcctcaagctgcattcggttaccactaaactcgtggggcgcgtggataaactc
gaggaggaagtctctaaaaacctcaccaaggagaatgagcaaatcaaagaggatgtggaa
gaaatccgaacggagctgaacaagcgaggcaaggagaactgctctgacaacatcctaggg
aacatgccagacatccgctcagccctgcagagggatgcggccgcagcctacgcccaccca
gagtatgaagagaggtttctgcaggaggaaactgtgtcgcagcagatcaactccatcgaa
ctcctgcggacgcagccactggccccgcctacagtgatgaagccgcggcagccctcgcag
agacaggtgcacctgagaggtcggctggcctccaagcccaccgtcatcagggggatcact
tactataaagccaaggtctctgaggaggaaaatgacatagaagatcagcatgacgagctt
ttcagtggtgacagtggagtggacttgctcattgaagatcagctcctaagacaggaggac
ctactgatgagcgccacccgcaggccagcaaccactcgtcacgctgctgccgtgtccact
gacgcgagtgttcaggccacagccttatcctcggagcccgcacaggcctctgcctcagca
cccagccttgttgaccctgcttcccaggccccagatagacagctcttggcaagcccgcag
actaccacagtgtctccagagaccatgggagtgatgccttctactcaagtctcacccacc
accgtggcccacacagccatccagccacctccagcaatgattcctggggacatatttgtg
gaagctctacacttggttcccatgtcacctgacacagttggtacagacatggcagaggaa
gaggggactgccaggcaggaagcaacctctgctagtcccatactgagcccagaagaagaa
gatgacattcggaatgtcataggaaggtgcaaggacaccctgtctacaatcacggggccg
accacccagaacacatacggacggaatgaaggggcctggatgaaggaccccctagccaag
gatgaccggatttacgtaaccaactattactatggcaacacactggtagagttccgaaat
ctggagaacttcaaacaaggtcgctggagcaattcctataagcttccatatagctggatc
ggcacgggacatgtggtgtacaatggcgccttctactataaccgggccttcacccgtaac
atcatcaagtatgacctgaagcagcgctatgtggctgcctgggccatgctccatgatgtg
gcctatgaggagaccacaccctggcggtggcagggccactcggatgtggactttgctgta
gatgagaacggcctgtggcttatctacccagctctggatgatgagggcttcagccaggaa
gtcattgtcctgagcaagctcaatgccgtggacctgagcacgcagaaggagaccacgtgg
cgcactgggctccggcggaatttctatggcaactgctttgtcatctgcggggtactgtat
gctgtggacagctataaccagaggaatgccaacatctcgtatgcctttgacacgcacacc
aacacacagattgtccctaggctgctgtttgagaatgagtattcctacaccacccagata
gactacaaccccaaggaccgcctcctctatgcctgggacaatggccaccaggtcacctac
catgtcatctttgcctactga

DBGET integrated database retrieval system