KEGG   Rattus norvegicus (rat): 304962
Entry
304962            CDS       T01003                                 

Gene name
Atf6
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 alpha
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    304962 (Atf6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    304962 (Atf6)
   05012 Parkinson disease
    304962 (Atf6)
   05014 Amyotrophic lateral sclerosis
    304962 (Atf6)
   05022 Pathways of neurodegeneration - multiple diseases
    304962 (Atf6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    304962 (Atf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    304962 (Atf6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    304962 (Atf6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf AIRC Docking Macoilin ZapB
Other DBs
NCBI-GeneID: 304962
NCBI-ProteinID: NP_001100666
RGD: 1305471
Ensembl: ENSRNOG00000024632
UniProt: G3V909
Position
13
AA seq 656 aa
MESPFSPVLPHGPGEDWESTLFAELGYFTDTDDVQFDAAHETYENNFDHLNFDLDLMPWE
SDIWSPSSHFCSDIKAEPQPLSPASSSCSVSSPRSTDSCSSTQHVPEELDLLSSSQSPLS
LYGDSCHSPSSAEPLKEEKPVTGPGNKTEHGLTPKKKIQMSSKPSVQPKPLLLPAAPKTP
ANASVPAKTIIIQTLPALMPLAKQQSIISIQPAPTKGQTVLLSQPAVVQLQTPGVLPSAQ
PVLAVTGGATQLPNHVVNVVPAPVVNSPVNGKLCVTKPVLQSSTRSTGSDIAVLRRQQRM
IKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGSLKRQLDQVVSENQRLKVPS
PKRRAVCVMIVLAFIMLNYGPMSMLEQDSRRVKPSVSPANQRRHLLEFSAKEVKDTSDGD
NQKNSYRYDHSVSNDKALMVLSEEPLLYIPPPPCQPLINTTESLRLNHELRGWVHRHEVE
RTKSRRMTNSQQKTRILQGALEQGSNSQLMAVQYTETTSISRNSGSELQVYYASPGSYQG
FFDAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININDNVINGQDYEVMM
QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTATETTHVVSTLPESVQ
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggagtcgccttttagtccggttcttcctcatggaccaggtgaagactgggagtccacg
ttgtttgctgagcttggctatttcacagacacggatgatgtccagtttgatgcagcacat
gagacttacgaaaataattttgatcatcttaattttgatttggatttgatgccttgggag
tcagacatatggagccccagcagccacttctgctcagacattaaggcagagccccagcct
ctttctccggcttcctccagttgttctgtctcttctcctcggtccacagactcctgttct
tcaactcagcacgttcctgaggagttggacttgttgtctagttctcagtctcccctttcc
ttgtatggcgacagctgtcacagcccctcctcagcagagccactgaaggaagagaagcct
gtcactggtcctggaaacaaaacggaacatggactgactccaaagaaaaaaatccagatg
agttcaaaaccttcagttcagcccaagcctttgttacttccagcagcacccaagactcca
gcaaacgccagtgtcccagcaaagaccatcatcattcagacactgccagccctgatgcca
ctggcaaagcagcagtcgattatcagtatacagcctgcgcccaccaaaggtcagactgtt
ttgctctctcagcctgctgtggttcaacttcagacccctggagttctgccctctgctcag
ccagtacttgctgtcactggcggagccacacagctacctaaccatgtggtgaatgtggtg
ccagccccggtggtgaacagcccggtgaacggaaaactgtgtgtgactaaacctgttcta
caaagcagcaccagaagcacgggttcagatattgccgtactgaggagacagcagcgtatg
atcaagaaccgagagtctgcttgtcagtcacgaaagaagaagaaagagtatatgctaggc
ctggaggccaggttgaaggccgccctctccgagaatgagcagctgaagaaggagaatggg
tccctgaagcgacagctggaccaggtggtgtcagagaaccagaggctcaaagtcccaagt
ccaaagcgcagagctgtctgtgtgatgatagtattagcatttatcatgctgaactatggg
cccatgagcatgctggagcaagattccaggagagtgaaacctagtgtgagccctgccaat
caaaggaggcatcttttagagttttcagcaaaagaagttaaagacacgtcagatggtgac
aaccagaaaaacagttacagatatgatcattctgtgtccaatgacaaagccttaatggtg
ctaagtgaagaaccattactttatatccctccacctccatgtcagcccctcattaacacg
acagagtctctcaggttgaaccatgaacttcgaggctgggttcatagacatgaagtggaa
aggaccaaatcgagaagaatgacaaatagccagcagaaaacccgcattctccagggtgct
ctggaacagggctcgaattctcagctgatggctgtccagtacacagaaaccactagcatc
agtaggaattctgggagtgagctgcaggtgtattacgcttcgcctggaagttaccaaggc
ttctttgacgccatccgcaggaggggagatacattttacgtcgtatcatttcgaagggat
cacctgctattaccagctaccacccataacaagaccacaagaccgaagatgtccattgtg
ttaccagcaataaacataaatgataacgtgatcaatgggcaggattatgaagtaatgatg
cagattgactgtcaggtcatggacaccaggatcctccacatcaaaagctcctcggttccc
ccgtatctccgagatcatcagagaaaccaaaccagcaccttcttcggttcccctcccaca
gccacagagacgacccatgtggtcagcaccctccctgagtcggtacagtag

DBGET integrated database retrieval system