KEGG   Rattus norvegicus (rat): 304966Help
Entry
304966            CDS       T01003                                 

Gene name
Fcgr3a, Fcgr4
Definition
(RefSeq) Fc fragment of IgG, low affinity IIIa, receptor
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04650  Natural killer cell mediated cytotoxicity
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    304966 (Fcgr3a)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    304966 (Fcgr3a)
  09158 Development
   04380 Osteoclast differentiation
    304966 (Fcgr3a)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    304966 (Fcgr3a)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    304966 (Fcgr3a)
   05152 Tuberculosis
    304966 (Fcgr3a)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    304966 (Fcgr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304966 (Fcgr3a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    304966 (Fcgr3a)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    304966 (Fcgr3a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    304966 (Fcgr3a)
CD molecules [BR:rno04090]
 Proteins
  304966 (Fcgr3a)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  304966 (Fcgr3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 ig V-set Ig_4 I-set Ig_5 DUF3426
Motif
Other DBs
NCBI-GeneID: 304966
NCBI-ProteinID: NP_997486
RGD: 1303067
Ensembl: ENSRNOG00000024382
UniProt: Q6XPU4
Position
13q24
AA seq 249 aa AA seqDB search
MWYLLLPTALLLTVSSGVGAGLQKAVVNLDPEWVRVLEEDCVILRCQGTFSPEDNSTKWF
HNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEG
DPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNI
SSASLQISIGDPTSPSSFLPWHQITFCLLIGLLFAIDTVLYFSVQRSLQSSVAVYEEPKL
HWSKEPQDK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacctactactaccaacggcactgctacttacggtttcctctggcgttggagct
ggtctccaaaaggctgtggtgaacctagaccctgaatgggtcagggttctcgaggaagac
tgtgtgatcctcaggtgccagggcaccttctcccccgaggacaattctaccaaatggttc
cataacaaaagcctcatctcgcaccaggacgccaactatgtcatccaaagtgccagagtt
aaggacagtggaatgtacagatgccagacagccttctccgcgctcagtgacccggtgcag
ctagacgtccatgcagactggctattgcttcagaccactaagcggctgttccaggagggg
gaccccattcgtctgagatgccatagctggcgaaacacgcctgtatttaaggttacctat
ttacagaatggcaaaggcaagaagtatttccataggaattctgaactcagtatttcaaaa
gctacgcacgccgacagtggttcctacttctgcagagggatcattggacgcaacaacata
tcttcagcatccttgcagataagcataggagatccgacgtctccctccagctttctaccg
tggcatcaaatcactttctgcctgctgataggactcttgtttgcaatagacacagtgctg
tatttctcggtgcagaggagtcttcaaagttccgtggcagtctatgaggaacccaaactt
cactggagcaaggaacctcaggacaagtga

DBGET integrated database retrieval system