KEGG   Rattus norvegicus (rat): 304979Help
Entry
304979            CDS       T01003                                 

Gene name
Igsf8
Definition
(RefSeq) immunoglobulin superfamily, member 8
  KO
K06730  immunoglobulin superfamily, member 8
Organism
rno  Rattus norvegicus (rat)
Brite
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   304979 (Igsf8)
  Exosomal proteins of breast cancer cells
   304979 (Igsf8)
  Exosomal proteins of colorectal cancer cells
   304979 (Igsf8)
  Exosomal proteins of bladder cancer cells
   304979 (Igsf8)
  Exosomal proteins of melanoma cells
   304979 (Igsf8)
CD molecules [BR:rno04090]
 Proteins
  304979 (Igsf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig
Motif
Other DBs
NCBI-GeneID: 304979
NCBI-ProteinID: NP_001014787
RGD: 1311500
Ensembl: ENSRNOG00000007604
UniProt: A0A140TAA1
Position
13q24
AA seq 611 aa AA seqDB search
MGVPSPTPLSSLLLLLLILGARCYARQVHVPKGPLYRVAGTAVSISCNVSDYEGPSQQDF
EWFMYRPEAPATSLGIISTKDSQFSYAVFGPRVASGDLQVQRLKGDSVVLKIARLQAQDS
GFYECYTPSTDTQYLGNYSAKVELRVLPDELQVSAAPPGPRGRQVATSPSRLTVHEGQEL
ALGCLAQTKTKKHTHLSVSFGRAIPEAPVGRATLQEVVGLRSDMAVEAGAPYAERLVAGE
LRLSKEGTDRYRMVVGGAQAGDSGTYHCTAAEWIQDPDGSWVQVAEKRAVLAHVDVQTLS
SQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPAGAPGPGRLVAQL
DTEGIGSLGPGYEDRHIAMEKVASRTYRLRLEAARPADAGTYRCLAKAYVRGSGTRLREA
ASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASWWVE
RPEEGELSSGPAQLVGGVGQDGVAELGVRPGGSPVSVELVGPRSHRLRLHSLGPEDEGIY
HCAPSAWVQHADYSWYQAGSARSGPVTVYPYTHALDTLFVPLLVGTGVALVTGASILATI
TCCFMKRLRKR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtccctagccccacgccgctgagttcgctgctgctgctgctgctaatacttgga
gccaggtgctacgcccggcaggtgcacgtccccaaggggcctctttaccgtgtggctggc
accgctgtctctatctcctgcaatgtgagtgactatgagggcccttcccagcaagacttc
gagtggttcatgtacagacccgaggccccagctacgtcactaggcatcatcagcaccaag
gacagccagttctcctatgctgtctttgggcctcgagtggcatctggtgacctgcaggtg
cagcgcctgaagggggactccgtggtgctcaagattgctcgcctgcaggcccaggactct
ggcttttatgagtgctacaccccctctacggatactcagtacctgggcaactacagtgcc
aaggtggagctgagagttcttccagatgagctgcaggtatctgctgcccctccagggccc
cgaggacgccaggtggcaacctccccgtcacgcctcacagtacatgaggggcaagagctg
gcgctgggctgcctggctcagaccaaaacgaagaaacacacacacctgtcggtgtctttt
gggagagccattcctgaggcgccagtggggcgagccaccctacaggaagtagtgggactg
cgctctgacatggctgtggaggccggagctccctatgctgagaggctggttgccggggag
cttcggctgagcaaggaagggactgatcggtaccgcatggtggttgggggtgcccaggct
ggagactccggcacctaccactgcactgccgctgagtggattcaagatcctgatggctcc
tgggttcaggtcgcagagaagagggcagtcctggctcatgtggatgtgcagacactgtcc
agccagctagcagtgacagtgggacctggtgaacggcggattggcccaggggaacccttg
gaactgctgtgtaatgtgtcgggggcattgcccccagcaggccgtcatgctgcatactct
gtgggctgggagatggcccctgcaggggctccagggcctggacgcctggtggcccagctg
gacacagaaggtataggcagcctgggccctggctatgaagacaggcacattgccatggag
aaagtagcatccagaacctaccgactacggctggaggctgccaggcccgctgacgcgggc
acctaccgctgcctcgccaaagcctacgttcgaggctctgggacccggcttcgtgaagca
gccagtgctcgttcccggcctctcccggtgcatgtgagagaagaaggcgtggtgctagag
gccgtggcgtggctagcagggggcactgtgtaccggggagagaccgcctccctgctgtgt
aacatctctgtgcggggcggccccccggggctgcgactagcagccagctggtgggtggag
agaccagaggagggcgaactgagctctggtcctgctcagcttgtgggtggagtgggtcag
gacggtgtggcagagctgggagtccggcctggagggagtcctgtcagtgtggagctggtg
ggacccagaagtcatcggctgagactgcacagcttggggcccgaggacgaaggcatatac
cactgtgcgcccagcgcctgggtgcagcacgctgactatagctggtaccaggcaggcagt
gcgcgctccgggcccgtcacggtctacccctacacgcatgctctggataccctgtttgtg
cccttgttggtgggtacaggagtcgccctagttacgggagccagcatcctcgctaccatc
acctgctgttttatgaagaggctgaggaagcggtga

DBGET integrated database retrieval system