KEGG   Rattus norvegicus (rat): 304982Help
Entry
304982            CDS       T01003                                 

Gene name
Igsf9
Definition
(RefSeq) immunoglobulin superfamily, member 9
  KO
K22655  immunoglobulin superfamily member 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    304982 (Igsf9)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  IGSF9
   304982 (Igsf9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_6
Motif
Other DBs
NCBI-GeneID: 304982
NCBI-ProteinID: NP_001100667
RGD: 1304566
Ensembl: ENSRNOG00000008054
UniProt: P0C5H6
Position
13q24
AA seq 1179 aa AA seqDB search
MIWCLRLTILSLILSQGADGRRKPEVVSVVGRAGESAVLGCDLLPPAGRPPLHVIEWLRF
GFLLPIFIQFGLYSPRIDPDYVGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQ
DFANGSWVHLTVNSPPQFQETPPLVLEVKELEAVTLRCVALGSPQPYVTWKFRGQDLGKG
QGQVQVRNGTLWIRRVERGSAGDYTCQASSTEGSVTHTTQLLVLGPPVIVVPPNNNTVNA
SQDVSLACRAEAYPANLTYSWFQDRINVFHISRLQSRVRILVDGSLWLQATQPDDAGHYT
CVPSNGFPHPPSASAYLTVLYPAQVTVMPPETPLPIGMRGVIRCPVRANPPLLFVTWTKD
GQALQLDKFPGWSLGPEGSLVIALGNEDALGEYSCTPYNSLGTAGSSPVTRVLLKAPPAF
IDQPKEEYFQEVGRDLLIPCSARGDPPPIVSWAKVGRGLQGQAQVDSNNSLILRPLTKEA
HGRWECSARNAVAHVTISTNVYVLGTSPHVVTNVSVVPLPKGANVSWEPGFDGGYLQRFS
VWYTPLAKRPDRAHHDWVSLAVPMGATHLLVPGLQAYTQYQFSVLAQNKLGSGPFSEIVL
SIPEGLPTTPAVPRLPPTEMPPPLSPPRGLVAVRTPRGVLLHWDPPELIPERLDGYILEG
RQGSQGWEILDQGVAGTEIQLLVPGLIKDVLYEFRLVAFADSYVSDPSNIANISTSGLEV
YPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAACLMNRRRAARRHRKRLRQDPPLI
FSPRGRSGPHSAPGSDSPDSVTKFKLQGSPVPSLRQSLLWGEPARPPSPHPDSPLGRGPL
PLEPICRGPDGRFVMGPTVAPPQEKLCLERSEPRTSAKRLAQSLDCSSSSPSGVPQPLCI
TDISPVGQPPAAMPSPLPGPGPLLQYLSLPFFREMNVDGDWPPLEEPTPASPPDFMGSHP
CPTSSFLPPPDSPPTNLRAVLPGTLMGVGVSSEPPYTALADWTLRERVLPGLLSAAPRGS
LTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASGPERWPRREHVVTVSKRRNT
SVDENYEWDSEFPGDMELLETWHPGLASSRAHPELEPELGVKTPEKSCLLNTTHAPGPEA
RCAALREEFLAFRRRRDATRARLPVCQQSISYPEQATLL
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgatttggtgtctccgtctgaccatcctcagcctgatcctcagccaaggggctgacggt
cgaaggaagcctgaggtggtctctgtggtgggccgggctggggagagtgcagtgctgggc
tgtgacttgctgcctccagctggccgcccccctctgcatgtcatcgagtggctgcgcttt
ggattcctgcttcccatcttcatccagttcggcctctactctccccgaattgaccctgat
tacgtgggacgagtccgtctgcagacaggagcatctctccagattgaggggctccgggtg
gaagaccagggttggtacgagtgccgcgtgctcttcctggaccaacacagccctgagcag
gattttgccaatggctcctgggtgcacctgacagtcaattcgccccctcagttccaggag
acgcctcccttagtgttggaagtgaaggaactggaggctgttaccttgcgctgtgtggcc
cttggcagccctcagccttatgtgacttggaaattccgaggacaagaccttggcaaaggc
cagggtcaggtgcaagtgcggaatggaacactgtggatccgtcgggtggagcgaggcagc
gctggagactacacctgccaagcctccagcactgagggcagcgtcacccacactactcag
ctgctggtgctaggaccccctgtcattgtggtgccccccaacaacaacacagtcaatgcc
tcccaggatgtctctttggcttgccgggctgaggcataccctgcaaacctcacctatagc
tggttccaggatcgtatcaatgtcttccacatcagccgcttacagtctcgagtgcggatc
ctggtagatggaagcctgtggctacaggccactcagcctgatgacgccggccactatacc
tgtgttcccagcaatggctttccgcatccaccctcagcttctgcctatctcactgtgctc
tacccagcccaggtgacagtcatgcctcccgagacacccctgcccattggcatgcgtggg
gtgatacggtgtccggttcgtgctaatcccccactactgtttgtcacctggaccaaagac
ggacaggccttacagctggacaagttccctggctggtccctgggtccagaaggctccctc
gtcattgccctgggaaatgaggatgccttgggagaatactcctgcacgccctacaacagt
cttggtacggctggatcctcccctgtgacccgagtgctgctcaaggctcccccggctttt
atagaccagcccaaggaagagtatttccaagaagtagggcgggacctactcatcccttgc
tccgcccggggagaccctcctcctattgtctcttgggccaaggtgggacgggggctgcag
ggccaggcccaggtggacagcaacaacagcctcatccttcgacccctgaccaaggaggcc
catggacgatgggaatgcagcgccagaaatgctgtagcccacgtgaccatttctaccaac
gtatacgtgctaggcaccagtccccatgtcgtcaccaatgtgtctgtggtacctttaccc
aagggtgccaatgtctcttgggagcctggctttgacggtggctatctccagagattcagt
gtctggtataccccactagccaagcgtcctgaccgagctcaccatgactgggtatctctg
gctgtgcctatgggggctacacacctcctagtgccagggctgcaggcctacacgcagtat
cagttcagtgtccttgctcagaacaagctgggcagtgggcctttcagcgagatcgtcctg
tctatacctgaggggcttcctaccacaccggctgtccctaggcttcctccgacagagatg
ccacctcccctgtcccctcctagaggtttggtggcagtgaggacaccccggggggtcctt
ttgcattgggatcccccagaactcatccctgagagactggatggctacatcctggaggga
cggcaaggctcccaaggctgggagatcctggaccaaggtgtggctggcacggaaattcag
ctgctggtccctggcctcatcaaggacgttctctatgagtttcgcctcgtggcctttgct
gatagctacgtcagtgaccccagtaacatagccaacatctccacttccggcctggaggtg
tacccatcccgcacacagctaccgggtctcctgccccagcctgtattggctggtgttgtg
ggtggagtctgcttcttgggcgtggccgtccttgtgagcatcctggctgcctgcctcatg
aatcggcgaagggctgctcgccgccacaggaaacgtctacgccaggatccacctctgatc
ttctctccacgtgggaggtcaggcccacactctgctcctggctcagacagccctgacagc
gtgaccaagttcaagcttcaaggctccccagtccccagcctacgccagagtctgctttgg
ggggagcctgcccgaccacctagccctcacccggattctccacttggtcggggaccttta
ccattagagcccatttgcaggggcccagatgggcgctttgtgatgggacccactgtggca
cccccacaagaaaagttatgcctggagcggtcagaacctcggacctcagctaaacgcttg
gcccaatcccttgactgtagcagtagcagccccagtggggtcccacagcccctctgcatc
acagacatcagccctgtggggcagcctcctgcagccatgcctagccccctaccaggtccg
ggaccgctgctccagtacctgagcctgcctttcttccgagagatgaatgtggatggggac
tggccacctcttgaggagcccacacctgcctcacctccagatttcatgggtagtcatccc
tgccccacctcatctttccttcctccacccgactcacctcctacaaacctcagggcagtg
cttcctgggacactgatgggggtcggggtctcctcagagcccccttacacagctttggct
gactggacactgagggagcgggtgttgccaggccttctctctgctgcccctcgtggcagc
ctcaccagccagagcagtgggcggggcagtgcttccttcctgcgccctccctccacagcc
ccctctgcagggggaagctacctcagtccagctccaggagacacaagcagctgggccagt
ggccctgaaaggtggccccgaagggagcacgtggtgacagtcagcaaaaggaggaacacc
tctgtggatgagaactatgaatgggactcggaattcccgggggacatggagctgctggag
acttggcacccaggcttggccagttctcgggcccaccctgagcttgagccagagttaggt
gtcaagactccagagaagagctgtctcctgaacaccacccacgctcccggccccgaggcc
cgctgtgctgctcttcgggaggaattcctggctttccgacgacgcagggacgctaccagg
gcccggttaccagtctgtcagcagtccatctcttaccctgaacaggctactctgctatga

DBGET integrated database retrieval system