KEGG   Rattus norvegicus (rat): 304988
Entry
304988            CDS       T01003                                 

Gene name
Mnda, Ifi204, rHin-3
Definition
(RefSeq) myeloid cell nuclear differentiation antigen
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 304988
NCBI-ProteinID: NP_001012029
RGD: 1306089
Ensembl: ENSRNOG00000003486
UniProt: Q5U2R8
Position
13q24
AA seq 438 aa
MSNEYKRIVLLKGLEPLSSHHFSLFKSLLASDLKLERHMQEQYTKVQIADMMEDEFPDDA
GLGKFIKFCEDLPALRKRAEILKRERIQVRGETPREINRREPGPSRPSSTASHMIVSEGW
ETSTAQAETSTAQGEPSTAQKRKSMSEGKTEVKKTKASERPDQPPCPEEATAKCLSPIPQ
TSSLAPCNSPLAKCSMENQNIQTQNQNIPRGAVLQTEPLTVMVLKATDPFEYESAEHGVK
NMFLATVVTVDRYFHVKVFNSNLKEKFKKNNFIIISNYFKRTDILEINEASLVSEAAPDK
KIAVPNKRIKEAKKSPKIRDIKEGTSRDLFYGVFTLIKKKVCPKNTIYELKDDTGNIEVV
GSGKWYNINCNEGDNFQLFCFHLKTIDRQQKLVCGKHSFIKVTRAREKKEAATAHPSTKK
EEGTHYPKDKFNAFKEEK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcaaatgaatataagagaatcgttctgttgaaaggacttgaacctctcagtagtcat
cattttagcttatttaagtcattgctggccagtgatttaaaactggagagacacatgcag
gagcaatacaccaaggtccagattgctgacatgatggaagatgaattcccagatgatgct
ggattgggcaaattcatcaaattttgtgaagacttaccagctcttagaaaacgtgctgaa
attcttaaaagagagagaatacaagtaagaggagaaaccccacgggaaataaataggcga
gaaccaggtccgtcaagaccttcatcaactgcaagccatatgatagtgtctgaaggatgg
gagacttccacagctcaggcagagacctccacagctcagggagagccttctacagctcag
aaaagaaaaagtatgagcgaaggaaagactgaagtgaaaaagaccaaggcatcagagaga
ccagatcagcctccctgtcctgaagaagccacagccaagtgtctgtcaccaataccccag
acttcgtctttggctccatgtaactctcctttggctaagtgttcaatggagaaccaaaat
atacagacccaaaaccagaacattcccagaggcgctgttctccaaacagaacccctgaca
gtgatggtgctcaaagcaacagacccatttgaatatgaatcagcagaacatggagtgaag
aacatgtttcttgctacagtggttactgtagaccggtatttccatgtgaaagttttcaac
agcaacttgaaagagaagttcaaaaaaaataattttatcatcatttccaattacttcaag
aggacagacatcctagagatcaatgaagcttcccttgtgtcagaggctgctcctgacaaa
aagattgcagtgcccaacaaacgtatcaaagaggcaaaaaaatctcctaaaatccgtgat
attaaagagggtacttcaagggatctgttttatggagtgtttacattaatcaagaaaaaa
gtgtgcccaaagaacacaatctatgaactaaaagatgatacaggaaatatagaagtggtg
gggagtggaaaatggtacaacatcaactgtaacgaaggagataacttccaactcttctgc
tttcacctgaaaacaattgacaggcaacaaaaattagtgtgtggaaagcacagttttatc
aaggtcaccagagctcgggaaaaaaaggaagcagccactgcccatccaagcacaaaaaag
gaagaaggaactcactaccctaaagacaaattcaatgcttttaaagaagagaaataa

DBGET integrated database retrieval system