KEGG   Rattus norvegicus (rat): 305078Help
Entry
305078            CDS       T01003                                 

Gene name
Lamb3
Definition
(RefSeq) laminin subunit beta 3
  KO
K06244  laminin, beta 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    305078 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    305078 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    305078 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    305078 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    305078 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    305078 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    305078 (Lamb3)
   05145 Toxoplasmosis
    305078 (Lamb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF F5_F8_type_C Laminin_II BNR_6
Motif
Other DBs
NCBI-GeneID: 305078
NCBI-ProteinID: NP_001094311
RGD: 1562668
Ensembl: ENSRNOG00000006025
UniProt: F1LPI5
Position
13q27
AA seq 1172 aa AA seqDB search
MMTALFLLWLALPGLLCAQQPCSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQY
GQWQMKCCKCDSRLPRNYNSHRVENVVSSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDI
MMDFKGLMPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQR
PNGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYF
AVSQLRLQGSCFCHGHADRCAPNPGGPTGSTTAVQVNDVCVCQHNTAGPNCDRCAPFYNN
RPWRPAEGQDIHECQRCDCNGHSETCHFDPAVFAASQGTSGGVCDNCQDHTEGKNCERCQ
LHYFRNRRPGAPIHETCIPCECDPDGAVPGAPCDRLTGQCVCKDHVQGERCDLCKPGFTG
LTFANPQGCHPCDCSILGTRQDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGRGCE
PCACDPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDRTHGDVATGCRACDCDFR
GTEGPGCDKTSGRCLCRPGLTGPRCDQCQRGYCDRYPVCVACHSCFQAYDTDLQEQAWRL
GSLRNTTEGLGTGTGLEDRGLASRLLDAKSKIEQIRQILGGTSVTERDVAQVANAILSIR
RTLQGLPLDLPLEEEMESFSGDLGNLDRSFNRLLLMYRSKKEQFEKLSSVDPSGAFRMLT
MAYEQSSRAAQQVSDSSSLLSQLRDSRREVEGLERQTGEGGAGGAQLMALRLEMASLPDL
TPTINKLCGGSRQTACTPGDCPGLLCPQDNGTACGSHCRGALPRARGALHMAGQVAEQLR
SFNTQLQQTRQMIRAAEEAASKVQSDAQRLETQVSTSRLQMEEDVRRTRLLIQQVRGFLT
DPHTDAATIQQVSEAVLALWLPTDSATVLRKMKEIQDIAARLPNVDLVLSQTKQDIARAR
RLQAEAEKARSRAHVVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVTEVQQ
VLVPAERLVKGMKEQMSGFWARVKELRHQAQEEQAQAMKAQQLAEGASNQAMNAQEGFER
LKQRYTELKDRLGQSSMLGEQGNRILSIKAEAEELFGETMEMMDKMKDMESELLRGSQAI
MLRSADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacttttcctcttgtggcttgccttgcctggcctcctgtgtgcccagcaa
ccctgctcccgaggggcctgttatccacctgttggggacttgctcattggaaggactcag
cttcttcgagcctcgtctacctgtggattgaccaagcctgagacctattgcacccaatat
ggacagtggcagatgaaatgctgcaagtgtgactccaggctgcctcgcaactacaacagt
caccgagtggagaacgttgtatcgtcttcaggccccatgcgctggtggcagtcccagaac
gatgtgagccctgtctctcttcaactggacctagacaagaggatgcagcttcaggacata
atgatggattttaagggtctcatgccagctggcatgttgattgagcgctcttctgacttt
ggcaagacatggagggtgtaccagtacctggcgacagactgtgccagcacctttccccag
gtccaccagggccagcccaagaactggcaggacgtccggtgccggcccttgtcccagagg
cctaatgggcatctgactgggggaaaggtccaacttaaccttatggatttggcatcagct
atccctgcatctcaaagtaaaaagattcaagaactaggagacatcacgaacttgagagtc
aacttcaccaagctggccccagtgccccagaggggctcctatccacccagcgcctacttt
gcagtatcacagctacgtctacaggggagttgcttctgtcatggacatgccgaccgctgt
gcccctaatcctggaggccctacaggttccaccaccgctgtgcaggtcaacgatgtctgt
gtctgccagcacaacacagctggccccaactgtgaccgctgcgcccccttctacaacaac
cggccatggagacctgcagagggacaggacatccatgagtgccaaaggtgtgactgcaat
gggcactcagagacctgccacttcgacccagctgtgtttgctgctagccaagggacaagt
ggaggcgtgtgtgacaactgccaggaccacacagagggcaagaactgtgagcgatgtcag
ctacactatttccggaatagacgaccaggcgctcccattcatgagacctgtattccctgc
gagtgtgatccagacggggcagtcccaggagctccctgtgaccgactgacgggccagtgc
gtgtgcaaagaccacgtgcaaggggagcgctgtgatctttgcaagcctggtttcacaggg
ctcaccttcgccaacccacagggctgccatccctgtgactgcagcatcttaggtacccgg
caagatatgccttgtgaggaggaaactggacgctgcttgtgtcttcccaatgtagtgggc
cccaaatgtgaccagtgcgccccttcccactggaagctggccagcggccggggctgtgag
ccctgtgcctgtgacccacgcaactccctcagctcccagtgcaaccagtttacagggcag
tgtccttgtcgggaagggtttggtggcctcacatgtagttctgcagccattcgtcagtgt
cccgaccggacccatggagacgtggccacagggtgccgagcctgtgactgtgacttcaga
ggaaccgagggtcctggctgtgacaaaacctcaggccgttgcctctgccgccccggcttg
acagggccccgctgcgaccagtgccaacgaggctactgcgaccgctacccagtgtgtgtg
gcctgccactcttgcttccaggcctatgacacagacctccaggagcaggcttggcgcctt
ggcagtctccgtaataccactgaaggcctgggcacagggacaggtctggaggaccgtggc
ctggcttctcggttgctagatgccaagagcaaaatcgagcagatcagacagattctgggt
ggcacctctgtcacagagcgggatgtggctcaagtggccaatgccatcctgtctatcagg
aggactcttcagggcctgcccctggacctacccttagaggaggagatggaatccttctct
ggagacctggggaatctagacagaagcttcaatcgcctcctccttatgtaccggagcaag
aaggagcagtttgagaagctaagcagtgtggacccttcaggagccttccgcatgctgact
atggcttatgagcagtcctcccgggctgcacagcaagtatccgacagttccagcctgctg
agccagctgagggacagtcgcagagaggtagaaggtctggagagacagactggagaggga
ggagctggaggagctcagctcatggccctgcgcctagagatggcttcactgcctgacttg
acacccaccatcaacaagctctgtggtggctctaggcagacagcctgcaccccaggagac
tgccctggattgctgtgtccccaggacaatggtacagcctgtggctctcactgcagggga
gccctgcccagagccagaggggccttacacatggcagggcaggtagctgagcagctacga
agcttcaatacccagctccagcagaccaggcaaatgatcagggcagctgaggaggcagca
tcaaaggtccaatcagatgcccagcgccttgagactcaggtgagtaccagccgcttacag
atggaggaagatgtccggcgcacacggcttctcatccagcaggtccggggcttcctcaca
gaccctcacacagatgcagccaccatccaacaggtgagcgaggcagtgctggctctctgg
ctgcccacagactcagctacagtgctacgcaagatgaaagagatccaggacattgctgcc
aggctccctaacgtggacttagtgctatcccagactaagcaggacattgcacgggcccgc
aggctccaggctgaggccgagaaggccagaagccgagcccacgttgtggaagggcaggtg
gatgacgtggtcgggaacctcaggcagggcaccgtggctctgcaggaggctcaggacact
atgcagggcactggccgctctcttcggctcatccaggaaagggttactgaggttcagcag
gtcctggtaccagctgaaaggctggtgaaaggcatgaaggaacagatgagtggattctgg
gcacgggtgaaggagctccgccatcaggcccaggaagagcaggcacaggcaatgaaggcc
cagcagcttgcagagggtgccagcaatcaggccatgaatgctcaggagggctttgagaga
cttaagcaaaggtatacagagttgaaagaccggctgggtcagagttctatgctgggtgag
caaggcaatcggatcttgagcatcaaggcggaggcagaggagctctttggggaaaccatg
gaaatgatggataaaatgaaagacatggagtcagagctgcttcgagggagtcaggccatc
atgcttcgttcagcagacctgtcggggctggagaagcgcgtggagcagatccgcagttac
atcaacgggcgtgtgctgtactatgccacctgcaagtga

DBGET integrated database retrieval system