KEGG   Rattus norvegicus (rat): 305081
Entry
305081            CDS       T01003                                 

Gene name
Cd34
Definition
(RefSeq) CD34 molecule
  KO
K06474  CD34 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    305081 (Cd34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    305081 (Cd34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    305081 (Cd34)
CD molecules [BR:rno04090]
 Proteins
  305081 (Cd34)
SSDB
Motif
Pfam: CD34_antigen SIR4_SID
Other DBs
NCBI-GeneID: 305081
NCBI-ProteinID: NP_001100672
RGD: 1306863
Ensembl: ENSRNOG00000045558
UniProt: B1PLB1
Position
13q27
AA seq 386 aa
MPVHRGARAGLLLPWGWVALCLMSLLHLNNLTSVASENSTQGVFPPVPTNESTEESITSS
IPGSTSHYYLIGQDSNKTTPAISETTVNFTATPGTPSGSGTPHTFSQPQTYPTVTLPTTS
DSTSTPEVEHSTWNTSLPSVNVSDYSPNNVSSEMISTTEPCAHTSSSVPSIIKGDIKCSG
IRGVPFTQGICLELSEASSCEEFKKERGEELMQILCKKEETEADAGTSVCSLNLAQSEVR
PECLLMVLANSTELSSKLQLMEKHQSDLRKLGIQSFNKQDLGSHQSYSRKTLIALVTSGV
LLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPETQGKANVTRGA
QENGTGQATSRNGHSARQHVVADTEL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgccggtccacaggggcgcgcgcgcgggtctcctgctaccatggggctgggtagctctc
tgcctgatgagtctgctgcatctaaataacttgacttctgttgcctcggagaattctacc
caaggagtatttccaccagttcctacaaatgagtccactgaggaaagtatcacatctagc
atccctggaagtaccagccactactacttgattggtcaagatagcaataagaccacacca
gccatctcagagaccacggtcaactttacagctacccctgggaccccttcaggctctgga
actccacacactttttcacaaccacagacttacccaaccgtcacactgcctactacttca
gacagtacttctactccagaagtggaacactccacctggaacaccagcctgccgtctgtc
aatgtttctgattattcacctaataatgtcagctctgagatgatatcaaccactgagcca
tgtgctcacacatcatcttctgtcccaagtattattaagggagacatcaaatgttcagga
atccgaggagtgccatttactcagggcatctgcctggaactaagtgaagcatctagttgt
gaggagtttaagaaggaaaggggagaagagctaatgcaaatactgtgtaaaaaggaggag
actgaggccgacgctggtactagtgtctgctccttgaatctagcccagtctgaggttagg
cccgagtgtttgctgatggtcttggccaatagcacagaactttccagcaaactccagctt
atggaaaagcaccagtctgacttgagaaagctggggatccaaagcttcaataaacaagat
cttgggagccaccagagctattcccgaaagactctgattgcattggttacctcgggagtc
ctgctggccatcttgggcaccaccggctatttcctgatgaaccgccgcagttggagtccc
acaggagaaaggctgggtgaagacccttattacacggagaatggtggaggccagggctat
agctcaggacctgggacctcccctgagactcagggaaaggccaatgtgacccgaggggct
caggagaacgggaccggccaggccacttccagaaacggccattcagcaagacaacatgtg
gtggctgacacagaactgtga

DBGET integrated database retrieval system