KEGG   Rattus norvegicus (rat): 305120Help
Entry
305120            CDS       T01003                                 

Gene name
Rpap2, RGD1309034
Definition
(RefSeq) RNA polymerase II associated protein 2
  KO
K20827  RNA polymerase II-associated protein 2 [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    305120 (Rpap2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    305120 (Rpap2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     305120 (Rpap2)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   305120 (Rpap2)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     305120 (Rpap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPAP2_Rtr1
Motif
Other DBs
NCBI-GeneID: 305120
NCBI-ProteinID: NP_001014009
RGD: 1309034
Ensembl: ENSRNOG00000023484
UniProt: Q5I0E6
Position
14p22
AA seq 609 aa AA seqDB search
MADSAVPYSLGPSARASSTHRVATGTKQTSALKRRDASKRQAELEAALQRKVESERRAVR
LVEQLLEENITEEFLKECGMFITPAHYSDVVDERAIIKLCGYPLCQKKLGVIPKQKYRIS
TKTNKVYDITERKSFCSNFCYKASKFFEAQIPKTPVWVREEERPPEFQLLKKGQSGCSGE
VVQFFRDAVTAADVDAYGAFDAQCEPASSSTWSERASDERASDEEGPGFVSSLLPGNRPK
AVGTKPQPHRQSSTVKKKAAQKMTSKHGEQTVSEVTEQLSNCRLDSQEKVATCKLPAKKE
NTQISSPGPLCDRLNTSTVSENKHSVSQVTLVGISKKSAEHFRSKFAKSNPGSGSASGLV
QVRPEVAKANLLRVLKDTLTEWKTDETLKFLYGQDHGSVCLQPSAASGPDEELDEDDISC
QAQNTLDETLPFRGSDTAIKPLPSYESLKKETEMLNLRVREFYRGRCVLNEDSTKSQDSK
ENELQRDPSFPLIDSSSQNQIRRRIVLEKLSKVLPGLLGPLQITMGDIYTELKNLVQTFR
LSNRNIIHKPVEWTLIAVVLLSLLTPILGIQKHSPKNVVFTQFIATLLTELHLKCEDLEN
LAMIFRTSC
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcggactctgctgttccttactctctgggcccaagtgcccgggcttccagcacccac
cgagtcgctaccggtactaaacagaccagtgccctgaaacgaagagatgcgtctaaaaga
caagcggaactggaagctgccctgcaaaggaaggtggagtctgagaggagagctgtacgc
ctcgtagagcagctcctggaggagaacatcacagaagaattcctgaaggagtgtgggatg
ttcatcacaccggctcactacagcgacgttgtggatgagcgggccatcattaaactctgt
ggctatcctttatgtcagaagaagctaggggttataccaaaacagaaataccggatttct
actaaaaccaataaagtctatgatattactgaaagaaagtctttctgcagcaatttttgt
tacaaagcatctaaattttttgaagcacagattcccaaaactccagtatgggttcgagag
gaagagaggcctcctgaatttcagctgctgaagaaaggacaaagtggctgttctggagag
gtcgtacagttcttcagagacgccgttacagcagcagatgtcgatgcttatggtgccttt
gatgcacagtgtgaacctgcttcctccagcacttggagcgagcgtgccagcgacgagcgt
gccagcgatgaggaggggccaggctttgtttcttctcttctcccaggaaacagaccgaag
gccgtgggcacaaaaccacagccacacagacaaagcagcaccgtgaagaagaaggctgct
cagaaaatgacctccaagcacggagaacagaccgtgtcagaggtcacggagcagttgtct
aattgtagattagatagtcaggagaaagtagctacttgtaaacttcctgcaaagaaagaa
aacactcagatttcttcacctggccctttgtgtgacagattaaatacttcaacagtttct
gaaaataaacacagtgtatcacaagttactcttgtggggataagcaagaagagtgctgag
catttcaggagcaaatttgccaaatctaacccagggtctgggtcagcctctggtttggtg
caggtgcgtcctgaggtcgcaaaggcaaatttactccgagttctaaaggacaccctgact
gaatggaagacagacgaaacactgaagtttttatatggccaagaccatggttctgtgtgc
ctgcaaccctctgcagcctctgggcctgatgaagaacttgatgaagatgacataagctgt
caagctcagaacaccttggatgagacactccccttcagaggctcagatacagccattaag
ccactgccaagttatgagagcctgaaaaaggaaacagagatgttgaacctgagggtcagg
gagttctacagaggacgctgtgttttaaatgaagacagtaccaagtctcaggactcaaaa
gagaatgagcttcagcgtgatcccagcttccccctgattgattcgagttcccagaaccag
attagaagacggattgttcttgaaaaattgagcaaagtattgcccggccttttgggtcct
cttcagattacaatgggagatatttacactgaacttaaaaaccttgttcagactttcaga
ttatcaaatagaaacattatccacaaacctgtggagtggactttaatcgccgtggtcttg
ctgtcactgttgacaccaattctcggcattcagaagcattctccaaaaaatgtggtattt
acacagtttatagccaccctgctgacagaattgcatctaaaatgtgaagatctggaaaac
ttagccatgatatttagaaccagctgctaa

DBGET integrated database retrieval system