KEGG   Rattus norvegicus (rat): 305150Help
Entry
305150            CDS       T01003                                 

Gene name
Hsd17b13
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 13
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 305150
NCBI-ProteinID: NP_001009684
RGD: 1359553
Ensembl: ENSRNOG00000002212
UniProt: Q5M875
Position
14p22
AA seq 300 aa AA seqDB search
MNLILELLLLVGIIIYSYLESLVKFFIPQRRKSVAGQTVLITGAGHGIGRLTAYEFAKQK
SRLVLWDISKHGVEETAAKCRKLGAVVHVFVVDCSNRAEIYKSVDQVKKEVGDIEIVVNN
AGAIYPADLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHRVIP
YLIPYCSSKFAAVGFHRALTAELDTLGKTGIKTSCLCPVFVNTGFTKNPSTRLWPVLEPD
EVARSLIDGILTNKKMIFVPSYINISLIVEMFFPERVLKAINRIQNIQFEAIVGHRTKRK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcatcctggagcttctcttgctggtgggcatcatcatctactcctacctggag
tcactggtaaagttcttcattccccagagaagaaagtctgtggccggacagactgttctc
atcacaggagctggacacggaataggcaggctgacggcttatgaatttgcaaagcagaaa
agcagattggtcctgtgggatattagtaagcacggtgttgaggaaaccgcagccaaatgc
aggaaactgggggctgtcgtgcacgtgtttgtggtggactgcagcaaccgggcagagatt
tacaagtctgtggatcaggtaaagaaagaagttggtgacatagagattgtggtaaacaac
gctggggcaatttatccagccgaccttcttagcaccaaggatgaggagatcaccaagacc
ttcgaggtcaacatcctaggacatttttggatcataaaagcactccttccatcgatgctg
agaagaaactctggccacattgtcacagtggcttcagtgtgtggccacagagtgattcct
tatctcatcccatattgctccagcaagttcgctgctgtgggcttccacagagcactgact
gcagaactggacaccttggggaaaaccggtatcaaaacctcctgtctctgccctgtgttc
gtgaatactggcttcaccaaaaacccaagtaccaggttatggcctgtgttagagccggat
gaagttgcaaggagtctgatcgatgggatacttaccaacaagaaaatgatcttcgttccg
tcctatatcaatatctctctaatagtggaaatgttttttcctgaacgtgtcttaaaagct
ataaaccgtatacagaatattcagtttgaagcgattgtgggccacagaaccaagaggaag
taa

DBGET integrated database retrieval system