KEGG   Rattus norvegicus (rat): 305166Help
Entry
305166            CDS       T01003                                 

Gene name
Gpat3, Agpat9
Definition
(RefSeq) glycerol-3-phosphate acyltransferase 3
  KO
K13506  glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
Module
rno_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    305166 (Gpat3)
   00564 Glycerophospholipid metabolism
    305166 (Gpat3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    305166 (Gpat3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     305166 (Gpat3)
Lipid biosynthesis proteins [BR:rno01004]
 Phospholipid acyltransferase
  GPAT
   305166 (Gpat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase ELFV_dehydrog_N
Motif
Other DBs
NCBI-GeneID: 305166
NCBI-ProteinID: NP_001020841
RGD: 1565703
Ensembl: ENSRNOG00000002159
UniProt: Q4V8J4
Position
14p22
AA seq 457 aa AA seqDB search
MEGTDLVVKLLSTWLTLVGSLILLPSAFGLSLGISEIYMKILVKTLEWATLRIEKGAPKE
SVLKSPASMGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE
LVSWNLLTRTNVNFHYISPKLTIVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQ
LPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILAT
DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI
FPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSW
AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ
KTYSKMIVGNGSPSLALDSSTVDNHGSPEPAFRSESL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaggggacagacctggtggtgaagctcctctccacctggctgacgctggtgggcagc
ctcatccttttgccctccgccttcggactatccctgggcatctcggagatctacatgaag
atcctggtgaaaaccttggagtgggccacgttacggatcgagaaaggagcccctaaggag
tcagttctcaaaagcccagcttctatgggtattatccaaagagatgagtcacccatggaa
aaagggctctccggtcttcgaggaagggacttcgagctctccgatgtgttttatttctcc
aagaaggggttggaagccattgtggaggatgaagtgacccagaggttctcctccgaggag
ctagtatcatggaatctcctcacaagaaccaatgtcaactttcactacatcagtccaaag
ctcaccatcgtgtgggtgctgggcgtcctcgtacgctattgcttcctgctccctctgagg
gtgaccctggctttcattgggatcagcttgctgattataggaacaacactggttggccag
cttccggacagcagcctcaagaactggctgagtgaactggtgcacctgacctgctgcagg
atctgtgttcgctccctgtctggcaccatccattaccataacaagcagtacagaccccag
aagggaggcatctgtgtcgccaatcacacctctcccatcgatgtcttaatcttggcgacg
gatggatgttatgccatggttggacaggttcatggtggactgatggggatcattcagaga
gccatggttaaggcttgtccacatgtctggtttgagcgctcagaaataaaggaccggcat
ctggtgactaagaggttaaaagaacacatcgctgataagaaaaagttacccattctaatc
ttccctgaaggtacctgcatcaacaatacttcagtcatgatgttcaaaaagggaagcttt
gaaattggaggaaccatatatccagtggcaataaagtataaccctcagttcggcgatgcc
ttctggaacagtagtaaatacaacctggtgagctatttgcttcggataatgacaagctgg
gccattgtctgcgatgtgtggtacatgcctcccatgaccagagaggaaggagaagatgcg
gttcagtttgccaacagggttaaatccgctattgctgtgcaaggaggactgactgaactt
ccctgggacgggggcctgaagagagcaaaggtgaaggacacctttaaggaagaacaacag
aagacttacagcaaaatgatcgtgggcaacggatctcccagcctggccctggactcaagc
actgtggacaatcatggctccccagagccggccttcagaagtgaaagcttataa

DBGET integrated database retrieval system