KEGG   Rattus norvegicus (rat): 305177
Entry
305177            CDS       T01003                                 

Gene name
Enoph1
Definition
(RefSeq) enolase-phosphatase E1
  KO
K09880  enolase-phosphatase E1 [EC:3.1.3.77]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    305177 (Enoph1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.77  acireductone synthase
     305177 (Enoph1)
SSDB
Motif
Pfam: Hydrolase HAD_2
Other DBs
NCBI-GeneID: 305177
NCBI-ProteinID: NP_001009391
RGD: 1309016
Ensembl: ENSRNOG00000002262
UniProt: Q5PPH0
Position
14
AA seq 261 aa
MVVVSVPAEVTVILLDIEGTTTPIAFVKDILFPYIKENVKEYLQTHWEEEECQQDVSLLR
KQAEEDAHLDGAVPIPVASGGDVQQMIQAVVDNVSWQMSHDRKTTALKQLQGHMWKAAFT
AGRMKAEVFADVVPAVRRWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELIDGHFDTK
IGHKVESDSYRKIADSIGCSTNNILFLTDVTVEASAAEEADVHVAVVVRPGNAGLTDDEK
TYYNLISSFSELYLPSTQSKV
NT seq 786 nt   +upstreamnt  +downstreamnt
atggtcgtggtttctgtgcccgccgaagtcaccgtaatcctgttagatatcgaaggtacc
acaaccccgattgctttcgtgaaggacattttatttccgtacattaaggaaaatgtcaag
gagtatctgcagacacactgggaggaggaggagtgccagcaggatgtcagcctgctgagg
aagcaggctgaagaagatgcacatctggatggggctgtcccgatacctgtggcatctggt
ggtgacgtgcagcagatgatccaggctgtggtagacaatgtgtcctggcagatgtctcat
gaccgcaagaccacggcgctcaagcagctgcagggccacatgtggaaggcggcgttcacg
gctggccgcatgaaggcagaggtctttgcagatgtggtccctgccgttagaaggtggcgg
gaagccgggatgaaggtgtacatctattcctcagggagcgtggaggcgcagaagctgctc
ttcggacattccacagagggagacattctggagctcatcgatggtcactttgataccaag
ataggacacaaagtggaaagtgacagttaccggaagattgcagacagcatcggctgctca
accaacaacatcctatttctcacggatgtcactgtagaggccagtgctgccgaggaagca
gacgtgcatgtggctgtggtggtgaggcctggcaatgcggggctaaccgacgacgagaaa
acctactacaacctcatctcgtccttcagcgagctctacctgccgtctacacagagcaag
gtctga

DBGET integrated database retrieval system