KEGG   Rattus norvegicus (rat): 305178Help
Entry
305178            CDS       T01003                                 

Gene name
Hnrnpdl, Hnrpdl, hnRNP_DL
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein D-like
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    305178 (Hnrnpdl)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    305178 (Hnrnpdl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 RRM_3
Motif
Other DBs
NCBI-GeneID: 305178
NCBI-ProteinID: NP_001028868
RGD: 1309950
Ensembl: ENSRNOG00000002270
UniProt: Q3SWU3
Position
14p22
AA seq 322 aa AA seqDB search
MTGTARSALPLPQSPARALRPSGAARAAPSLSPSRFSACPLDPSSFPTSGNKMFIGGLSW
DTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKL
IDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFC
FITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGARG
RGRGQGQNWNQGFNNYYDQGYGNYNSAYGDESYSGYGGYDYTGYNYGSYGYGQGYTDYSG
QQSTYGKASRGGGNHQNNYQPY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtaccgcacgctccgctcttcccctcccccagagccccgcgcgcgcccttcgt
ccctctggagccgcgcgcgctgcccccagtctttccccgagtcgattctccgcgtgcccg
ctggaccccagtagcttccccactagcggaaataaaatgtttattggaggcttgagctgg
gatacaagcaagaaagatctgactgaatatttgtctcggtttggggaagttgtagactgc
acaattaaaacagatccagtcactggaagatcaagaggatttggatttgtgcttttcaaa
gatgctgctagtgtggataaggttttggaactgaaggaacacaaactggatggcaaattg
atagaccccaaaagggccaaagctttaaaggggaaagaaccccctaaaaaggtttttgtg
ggtggattgagtccagatacttcagaagaacaaattaaagaatattttggagccttcgga
gagatagaaaacattgagctgcccatggatacgaagactaatgagagaagaggattctgt
tttatcacatacacagacgaagagccagtaaagaaactgttagaaagcagataccatcag
ataggctctgggaagtgtgaaatcaaagttgcacaacccaaagaggtgtacaggcagcag
cagcagcaacagaaaggtggaagaggggctgcggctggtggaagaggtggtgctagggga
cgcggaagaggtcagggccaaaactggaaccaaggatttaataactattatgatcaagga
tatggaaattataatagtgcctatggtgatgagagctatagtggctatggcggctatgac
tatacggggtataactatgggagctatggatatggacagggatatacagactacagcggt
cagcagagcacttatggcaaggcatcccgagggggtggcaatcaccagaacaattaccag
ccctactaa

DBGET integrated database retrieval system