KEGG   Rattus norvegicus (rat): 305258
Entry
305258            CDS       T01003                                 

Gene name
Utp3, Crlz1
Definition
(RefSeq) UTP3, small subunit processome component homolog (S. cerevisiae)
  KO
K14767  U3 small nucleolar RNA-associated protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    305258 (Utp3)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    305258 (Utp3)
SSDB
Motif
Pfam: Sas10 Sas10_Utp3
Other DBs
NCBI-GeneID: 305258
NCBI-ProteinID: NP_001012036
RGD: 1308540
Ensembl: ENSRNOG00000003599
UniProt: Q6AXX4
Position
14p22
AA seq 470 aa
MVKRSRRRGAAQWATVRAKAGRTATDENEDDLGSPPSPGDSSYYQDQVDEFHEARSRAVL
AKGWNEVESGEEDDDEEEEVLPLNIDDENDEDGESSEEEEDGEDDDGGSSVQSEAEASVD
PSLSWGQRKRLYYDTDYGSKSRGRQSQQEVEEEEREEEEEAQVIQRRLTQALQEDDFGVA
WVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDEL
EPLIQLVEKGVIPPGKGSQYLKTKYNLYLNYCANISFYLILKARRVPAHGHPVIERLVTY
RNLINKLSVVDQKLSSEIRHLLTAKEGAGKKDLNPKAKLTKTKPKSAKQTDVNADLTEEP
EFDEAALEFYKEMEDRPELKRKKEENSAEEQALEEQNAKRAITYQIAKNRGLTPRRKKID
RNPRVKHREKFRRAKIRRRGQVREVRREEQRYSGELSGIRAGVKKSIKLK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggtgaagcgatcacggcggcgtggagcggcccagtgggccaccgtgcgggccaaggct
ggtcgcactgccacggacgaaaatgaggacgatttagggtcgccgccttctccaggggac
tccagctactaccaagaccaggtagatgagttccatgaagcgcgatctcgggcagtcctg
gctaagggctggaacgaagtcgagagtggggaggaggatgacgatgaggaggaagaggtg
ctacctctaaatattgacgatgaaaatgacgaagatggagagagttccgaggaggaggag
gatggcgaagatgatgatggtgggagctccgtacagagtgaggctgaggcctctgtggat
cccagcttgtcctggggtcagagaaaaaggctttattatgatacagactacggttccaaa
tcccgaggccgtcagagtcagcaagaagtagaagaggaggaaagagaggaagaagaggag
gcacaggtaattcagcggcgcttaacccaagccctgcaagaggatgattttggagtcgct
tgggtggaggcctttgcaaaacccgtgccacaagtagacgaagctgagactcgggttgtg
aaggatttggctaaagtctcggtaaaagagaagctgaaaatgttgaggaaagagtcacca
gagctcttagaactgatagaagacctcaaagtcaagttgacagaagtgaaggatgagtta
gagcctttgatacagttggtggaaaagggggtcattccgcctggaaaaggaagccagtac
ctgaagactaagtataacctctacttgaattattgcgccaacatcagtttttatttgatc
ttaaaagccaggagagtccccgcacatggacatcctgttatagaaaggcttgttacctac
agaaatctgatcaacaagctctcagttgtggatcagaaactgtcctccgaaatccgtcac
ctactcacagccaaggagggtgctggaaagaaagacctgaatccaaaagcaaaattaacc
aagaccaagccaaagtctgcaaagcagactgatgttaacgctgacctgactgaagagcct
gagtttgatgaggctgcactagagttctacaaggaaatggaagacaggccagagttgaag
agaaagaaagaagaaaatagtgctgaagaacaggctcttgaagagcaaaacgccaagcga
gccattacctaccagatcgccaaaaataggggacttacacccaggagaaagaagattgat
agaaatcccagagtcaaacatagggaaaagttccgaagagccaaaatccgaagacgaggc
caggttcgtgaagttcgtagagaagaacagcggtatagtggtgaactctctggcattcgc
gctggagttaaaaagagcattaagcttaagtaa

DBGET integrated database retrieval system