KEGG   Rattus norvegicus (rat): 305268Help
Entry
305268            CDS       T01003                                 

Gene name
Uba6, RGD1308324, Ube1l2
Definition
(RefSeq) ubiquitin-like modifier activating enzyme 6
  KO
K10699  ubiquitin-activating enzyme E1-like protein 2 [EC:6.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    305268 (Uba6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    305268 (Uba6)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     305268 (Uba6)
Ubiquitin system [BR:rno04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   305268 (Uba6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ThiF UBA_e1_thiolCys E1_FCCH E1_4HB E1_UFD
Motif
Other DBs
NCBI-GeneID: 305268
NCBI-ProteinID: NP_001100683
RGD: 1308324
Ensembl: ENSRNOG00000021931
UniProt: D4A8H3
Position
14p21
AA seq 1053 aa AA seqDB search
MERSEPLAVLSCEEASCSSWGACGASKNLPTMTTESLEIDDGLYSRQRYVLGDTAMQKMA
KSCVFLSGMGGLGVEIAKNLVLAGIKALTIHDTKKCQAWDLGTNFFLCEDDVVNERNRAE
AVLHRVAELNPYVQVSSSSAPFDETTDLSFLEKYQCVVLTETKLTLQKKINNFCHSHCPP
IKFISTDVHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
TGQFLTFREINGMAGLNGSVQQITVISPFSFSIGDTTELDPYLHGGIAVQVKTPKIFNFE
PLESQIKHPKCLIADFSKPEAPLQIHVAMLALDQFQENYSRKPNIRCQQDSDELLKLTIC
ISETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQEVLKAVTGKFSPLCQWLYLE
AADTVESLGNLGHEEFLPRGDRYDAFRACIGNTLCQKLQNLNIFLVGCGAIGCEMLKNFA
LLGVGTGREKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAAEATLKINPQLKIDA
HLNKVCPATESTYSDEFYNKQDIVITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHT
EIIVPQLTESYNSHRDPPEEEIPFCTLKSFPAAVEHTIQWARDKFESSFSHKPSLFNKFW
QAYPSAEDVLQKIQNGQSLEGCFQVIKLLSRRPRMWSQCVELARLKFEKYFNHKALQLLH
CFPLDTRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQNAAKLYATVYCIPFSEKDLSV
DSLMDILSEVKIQEFKPSNKVVQTDETARKPDHVPVSSEDERNAVFQLEKALSSNKATKS
DLQMAVLSFEKDDDSNGHIDFITAASNLRAKMYNIEPADRFKTKRIAGKIIPAIATSTAA
VSGLVALEMIKVAGGYPFDAYKNCFLNLAIPIIVFTETSEVRKTEIRNGISFTIWDRWTV
HGKEDFTLSDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKK
YVDLTVSFAPDADGDEDLPGPPVRYYFSHDTDE
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtctgagccgttggctgtgctttcctgtgaagaagcgtcctgctcctcctgg
ggagcctgcggtgcaagtaaaaatttacctaccatgacaacagaatctttggaaatcgat
gatggattatacagtcgacagagatatgttctcggtgacacggcaatgcagaagatggcc
aagtcctgtgtcttcttaagtggtatgggtggtcttggagtggaaattgcaaagaatctt
gtacttgcagggattaaggcactgacaattcatgatacaaaaaaatgccaagcctgggat
ctagggaccaatttcttcttgtgtgaagatgatgttgttaatgagagaaacagggctgaa
gctgtacttcatcgtgttgcagaactaaatccttacgttcaggtctcatcatcctctgcc
ccttttgatgaaaccacagacctctctttcttagaaaaataccagtgtgtagtattgact
gaaacaaaactgacattacaaaagaaaatcaacaacttttgccattctcattgccctcca
attaagtttattagtacagatgtacatggaatttggtccaggttgttttgtgattttggt
gatgaatttgaagtttcagatacaacaggagaagaaccaaaagaaattttcatttcaaac
ataacgcaagctaatccaggtattgtcacctgccttgaaaatcatccccacaagcttgag
acaggacagttcctaacatttcgagaaattaatggaatggcaggcttaaatggatctgta
caacagataactgtgatatcaccattttccttcagcattggtgatactacggaactggac
ccatatttacatggaggcatagctgtgcaggttaagactcctaaaatattcaactttgaa
cccctggagagccagataaaacatccaaagtgccttattgcagattttagcaaacctgag
gcacctttacagattcatgtagccatgcttgccttggaccagtttcaggaaaactacagt
cgtaagccaaatatcaggtgtcagcaagattcagatgaactgttgaagctaacaatatgt
ataagtgaaaccttggaagagaagcctgaggtgaatgctgacattgtgcactggctttca
tggactgctcaaggctttttacccccacttgctgctgcagtcgggggtgttgctagccaa
gaagtattaaaagctgtgaccgggaagttttctcctttgtgtcaatggttgtatcttgaa
gcagcagataccgtggaatccctaggcaatcttgggcatgaagagtttctcccacgagga
gatagatacgatgccttccgtgcctgcattggaaatacattatgtcagaagctacagaac
ttgaatatcttcttagtaggatgtggcgccataggctgtgaaatgttaaaaaattttgca
ttactgggtgttggtacaggtagagagaaaggaatggtaacagttacagatcctgacttg
atagaaaaatccaacctaaacagacagttcctgtttcgccctcatcatatacagaaacct
aaaagctatactgctgctgaagcaactctgaaaataaatcctcaattaaaaatagatgca
cacctgaacaaagtctgtccagccaccgagagtacatacagtgatgaattttacaataag
caagacatcgtcattacagcactagataatgtggaagccaggagatatgtagacagccgc
tgtttagcaaatctacggcctctcttagattctggaacaatgggtaccaaaggacacacc
gaaattattgtacctcaattgactgaatcttataatagtcaccgagaccccccagaagag
gaaataccattttgcactctcaagtcctttccggcagctgtcgaacatactatccaatgg
gcaagagacaagtttgaaagttccttctcccataagccttcactgtttaacaaattttgg
caagcctatccttctgcagaagatgtcttacagaagatacaaaatggacagagtttagaa
ggctgttttcaagttattaagctgcttagcagaagacctagaatgtggtcccaatgtgta
gaattagcaagactaaagtttgaaaaatacttcaaccataaagcccttcagcttcttcac
tgctttcctcttgacacacgattgaaagatggcagtttattttggcagtcaccaaaaagg
cctccttctccaataaaatttgatttaaatgagcctttgcacctcagttttcttcagaat
gctgcaaaactatatgctacagtatattgcattccgttttcagaaaaggacttatcagta
gatagcctcatggacattctttcagaagttaaaattcaggaattcaagccttccaacaag
gttgttcaaacagatgaaactgcaaggaaaccagaccatgttcctgtctccagtgaagat
gagaggaatgctgttttccaactagagaaggctctttcctctaacaaagccaccaaaagt
gaccttcagatggcagtgctttcatttgaaaaagatgatgacagtaatggacacatagat
ttcatcacagctgcttccaaccttcgagccaagatgtataacattgaaccagctgaccgt
tttaaaactaaacgcatagctggtaaaattatacctgctatagcaacatctactgctgca
gtttctggcttggttgccttggagatgatcaaagtagctggtggctatccctttgacgct
tacaaaaactgtttccttaatttagccattccaataatagtgtttacagagacatctgaa
gtaagaaaaactgaaatcagaaacggaatatcatttacaatttgggacaggtggactgta
catggaaaagaagatttcactctctcagatttcataaatgctgttaaagagaagtatgga
attgagccaacaatggtggtgcagggagtcaaaatgctttatgttcctgtaatgccaggt
catgcaaaaaggctaaagttaacaatgcacaaacttgtgaagccttccactgagaagaaa
tatgtggatcttactgtgtcgtttgccccagacgctgatggagatgaagatttgccaggc
cctccagtaagatactacttcagtcatgacactgatgagtag

DBGET integrated database retrieval system