KEGG   Rattus norvegicus (rat): 305288
Entry
305288            CDS       T01003                                 

Gene name
Cep135, RGD1310726
Definition
(RefSeq) centrosomal protein 135
  KO
K16461  centrosomal protein CEP135
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    305288 (Cep135)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    305288 (Cep135)
   Centrosome duplication proteins
    Centriole replication proteins
     305288 (Cep135)
SSDB
Motif
Pfam: Crescentin APG6_N SlyX PKcGMP_CC HrpB7 Fib_alpha
Other DBs
NCBI-GeneID: 305288
NCBI-ProteinID: XP_001076228
RGD: 1310726
Ensembl: ENSRNOG00000002153
UniProt: D3ZI35
Position
14p11
AA seq 1140 aa
MTTAAERKYINIRKRLDQLGYRQTLSVDSLPLVEKLFSDLVHTTESLRQCRLSSVKAEKD
SANFDFVLEPYKLENTRLNKENNELYLELMKLREYSDKHIKDLKITLKKSSRETADLKFL
NNQYVHKVRLLEKESKAKDEKIQQLQEKNLRAVVQTPGGRKRNIAFRRQRMQIDEPAPPS
EVSSYPVPQPEDPYIADLLQVADNRIQELQEEVHQLQEKLAQMEKGVQDYSRQIELRERE
IERLSVAVDGGRSPDILSLETRNKTNEKLIAQLNIQVDFLQQANKELERRIQELMETKAT
VTTEVVNLSNRNEKLCQELTEIDQMAQQLERHKEQVLETADRELGEAKKEIKRNLSEMRN
LEEKMSKLQWELDVSNKEKERLNGELLLKSDLETVVHQLEQEKQRLNKKLQSFAVTEREL
TLEVERMRLEHGIKRRDKSPSRLDTFLKGIEDERDYYKKELEKLQHLIQRRSCSVIYCAR
EKPPIIKCSEKGDCNSDIHLITRERDELQRMLERFEKYMEDIQSNVKLLTAERDRLSVLY
KEAKEELSALRQESTGSLAPNNLVSCIEKEKERALSDLRRITAEKEALREKLKNIQELNV
VGKSELEKTIEHLTYINHQLENEKYELQSKILIMKETIESLESKSKLQAQKLSHVTGDSS
HQKTEMNSLRIVSEQLQRSLDDCQHRLSIKRGELESAQEQIKALEQKLESLSHRMTMQSE
ETHAMKKTIGVMDKEKDFLQETVDEKTEKIASLQDSLISKEKAITQLKVTVSECESSLNQ
LQETLTNRDREINSLRRQLDATHKELDDVGKSREISYKENRRLQDDLATMARENQEISLE
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENKDLLDRFQMLHNRAEDWEIKAQQA
EGENSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSQLEEEL
RRHESEKATVLGDVSSLRELCIKLDSGKDIMTHQLNSKGLELERAVAELENVKSESELLK
KQLMTERQTINSLESLLATNRDKEFQSHLTSHEKDTEIQLLKEKLNLSESKLTTQSRETS
MLRTKVTQLQTDYDNLKRLMSNEKYERERAIQELRRLGLPTSPLSSTLRSPMQSPEHINA
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgactacagctgcagagagaaagtatattaacattaggaaaaggttagaccagctgggc
taccgccagaccctgtcagtggacagtctgcctttggtagaaaaacttttcagtgatttg
gttcacacaacagaaagcctgcggcaatgcaggctgtcctcggtaaaagcagaaaaggac
agtgccaatttcgattttgttctggaaccttataaacttgaaaacacaagactgaataag
gagaataatgaattgtatctggagttaatgaagctgagagaatactcagacaagcacatt
aaagacttgaaaatcacactgaagaaatcctcacgagagacagctgatctgaagtttctg
aataaccagtatgtccacaaggtcagactcctggagaaagagagcaaagctaaggacgaa
aaaatccagcagcttcaagaaaaaaatctgcgtgcggtagtacagactcctgggggcagg
aaaagaaacattgcgtttaggcgccagcggatgcaaatcgatgagccagccccaccctcg
gaagtcagctcctacccagttcctcaaccagaagacccgtacatcgcggacctcctgcaa
gtggctgacaataggattcaggagctgcaggaggaagtgcaccagctgcaagagaaacta
gcgcagatggagaaaggagtgcaggactacagcaggcagatcgaactaagagaacgagaa
atagagcgactgtccgttgctgtggatggcggccgttcccctgacatcctgtctctggag
actagaaataaaaccaacgagaagcttattgctcagttaaatatccaggttgacttcctt
caacaagctaataaggaactggagaggcgtatccaagagctcatggagaccaaggcgaca
gtgacaactgaggttgtgaacctaagcaacagaaacgaaaagctctgccaggaactaaca
gaaatcgaccagatggcccagcagctggaaaggcacaaggaacaagtgctggagacggca
gacagggagctcggggaggcaaagaaagagattaaaagaaacctctctgaaatgcggaac
cttgaggaaaaaatgtcaaaactgcaatgggaattagatgtaagcaataaggagaaggag
agactgaatggtgaactacttttaaagtcagacctggagacggttgttcatcagcttgaa
caagaaaagcaaagacttaacaaaaaactgcagagttttgcagtcacagaaagagaactg
actctggaggttgagaggatgaggctagaacacgggataaaacgtcgagacaagtcgccc
tcccgtctagacacatttctgaaaggcatagaggacgagcgcgattattacaagaaagag
ctggagaaactgcagcatctcatccagcgaagatcatgctctgttatttactgtgctcgg
gagaaacctcctataatcaaatgctcagaaaagggtgactgcaattccgacattcatctg
atcacaagagaaagggatgagcttcagcgcatgctagaaagatttgagaaatacatggag
gatatacagtccaacgtgaaactgctgacggcagaaagggacagactaagtgtcctgtat
aaggaagcaaaggaagagttatctgcactaagacaggagtccactggttcactggccccc
aacaatcttgtaagttgtatagaaaaggagaaagaacgcgcattatctgacttaagaaga
attacagcagaaaaggaagctctgagagaaaagttgaaaaatatccaagaactgaatgtt
gttggaaaatcagaattagagaagactattgaacatttgacgtatattaatcaccagctt
gaaaatgaaaaatatgaattacaatctaaaatattaataatgaaagaaacaatagaatca
ttagagagcaaatcaaaactccaagctcaaaaacttagccatgtgactggtgactcatct
catcagaaaacagagatgaactcgctcaggatagtgagtgagcagctacagcggtcactt
gatgactgtcagcaccgactttccataaaaagaggtgaactcgaatcagcccaagaacaa
attaaagcgctggagcagaaactagagtctctgagccacaggatgacaatgcaaagcgaa
gaaactcatgcgatgaagaagaccattggcgtgatggacaaagaaaaggactttctccag
gagactgtggatgagaagacggaaaagatcgccagcctgcaagacagcctcattagtaaa
gaaaaagctattacccagttgaaggtcacagtctcggagtgtgaatcgtcactgaaccaa
ctacaagaaactttgactaatcgagaccgagagataaacagcctccgtcgccagcttgat
gcaactcacaaggaacttgacgatgttgggaaatctagagagatctcttataaggaaaat
agaaggttacaagatgacctggccacaatggcgagagaaaaccaggagatctcactggaa
ctggaagcagcagtgcaagagaaagaagagatgaagagcagggttcacaagtatatcact
gaggtgtcacgatgggagagcctaatggccgcgaaggaaaaagaaaacaaagacttgcta
gatagattccagatgcttcacaaccgtgctgaggactgggagatcaaagctcagcaagcg
gagggggagaacagctcagtccgcctagagctgctgtctattgatacagagagaaggcac
ctgcgagagcgggtggagctcctggagaaggagatccaggagcacataaatgcacatcac
gcttatgagtctcagatctcatcaatggctaaagccatgtctcagttagaagaagagctt
cgacgacatgagagtgagaaagccaccgtgttaggtgatgtgtcctctctccgagaactc
tgcattaagctcgactcaggcaaagacattatgacccaccagctgaattccaaaggcctt
gagctggagcgggcagtagcagagttggagaatgtaaaatcagaatcggagctgttaaaa
aagcagctgatgactgagaggcagacaattaacagccttgagtcgttgttagctacaaac
agagataaagaattccagtcccacctaacctcccacgagaaggacacagaaatccagctg
ctgaaggagaagttaaacctctcagaaagcaaactaactacccaaagccgagaaacctcc
atgcttcgaactaaagtgacacagttgcagacagattatgataatctgaaaaggctgatg
tcaaatgagaagtacgaacgagagcgagcaatccaagagctgcgccgactcggtcttccc
acgtcgcctctgagctccactctgagatcgcccatgcagtctcctgagcatataaatgca
tag

DBGET integrated database retrieval system