KEGG   Rattus norvegicus (rat): 305332
Entry
305332            CDS       T01003                                 

Gene name
Limch1, RGD1305269
Definition
(RefSeq) LIM and calponin homology domains 1
  KO
K24422  LIM and calponin homology domains-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    305332 (Limch1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  Other lim domain-containing proteins
   305332 (Limch1)
SSDB
Motif
Pfam: DUF4757 CH LIM
Other DBs
NCBI-GeneID: 305332
NCBI-ProteinID: NP_001178607
RGD: 1305269
Ensembl: ENSRNOG00000002318
UniProt: F1M392
Position
14p11
AA seq 1085 aa
MACPALGLEVLQPLQPEPPPEPAFAEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNTILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKNFDYS
RKLKNVLVTIYWLGKAANSCTSYSGTTLNLKEFEGLLAQMRKETDDIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHR
KLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYVPAPLRKKKAEREEYRKSWST
ATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVLPHSRARQEQLQLINNQLREE
DDKWQDDLARWKSRRRSASQDLIKKEEERKKMEKLMSGEDGTSERRKSIKTYREIVQEKE
RRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNVSSFP
NDPSPMKYLRQQSLPPPKFTATVETTIARTSVPESSVAAGTGSPSKTSTPNTVPMLTPRP
YSQPKNSQEVLKTFKVDGKVSMNGETARGDVEGKEKEDPTAVAPGPSLTKSQMFEGVATV
HGSPVQVKQGSNSIEINIKKPNSPPQELTAASEETESNGRDDENGEESSGARDVELDSAE
PQHFTTTVTRCSPTVALVEFSSSPQLRNEVPEEQDQKKPENEMSGKVELVLSQKVAKPKS
PEPEATLTFPFLDKMPETDQLHLPNLNSQADSPSSEKSPASTPFKFWAWDPEEERRRQEK
WQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTISSSSA
DQLSTSSSVTEGSGTRNKMDLENCQDRDKERRQNTPLQENDSDSSLKARESGLPEEHSSL
TQSPSANSENSVSKGISQDQQPETEAEASHCGTNPQSAQDPPWNQQISNPPTSKSEDVKP
KTLALEKSINHQIESPGERRKKSPRENFRAGPLSPCSPTPPGQSPNRSISGKKLCSSCGL
ALGKGAAMIIETLNLYFHIQCFRCGICKGQLGDAVSGTDVRIRNGLLNCTDCYMRSRSAG
QPTTL
NT seq 3258 nt   +upstreamnt  +downstreamnt
atggcttgccccgctctcggtctggaagtccttcaacccctgcagcccgaaccacctccg
gagcctgccttcgccgaggcacagaagtggatcgagcaagtcacgggtcgaagttttggt
gacaaagacttccggacaggactagagaatggaatccttctttgcgagttgctgaatgct
ataaagccaggacttgttaaaaagatcaatagattgcctacccccattgcaggattggac
aacaccatcttattcttgagaggctgtaaagagcttggccttaaagaatctcaactcttt
gacccaagtgacctccaggatacttccaacagggtcactgtcaagaacttcgattatagc
aggaagctgaaaaacgtgttggtgaccatttactggctggggaaagctgcaaatagctgc
acatcctacagtggaaccacactgaacctgaaggagttcgaaggactgttggctcagatg
cgaaaggagactgatgacattgaaagccccaagcgcagcatccgagacagtggctacatc
gactgctgggactctgaacgcagtgactccctttctcctcctcgccacggccgggatgac
tcctttgacagcctggattcttttggctcccgctccaggcagacaccttcaccagatgta
gttctcaggggaagcagtgatggaagaggaagtgattctgaatcagacttgccccaccgg
aagttgccagatgtgaagaaagatgatatgtccgcacgacggacttctcatggtgagccg
aaatcagcagtgccttttaaccagtacctcccgaacaaaagcaaccagacagcctatgtc
ccagcccctctgagaaagaagaaggcggagcgggaagaatacaggaagagctggagtacg
gccacctcccccctgggcggggaaaggcccttcagatacggtccgagaactcctgtgtca
gatgacgcagagagcacgagtatgtttgacatgcggtgtgaggaggaggcagcggtgctg
ccgcacagcagggcccgccaggagcagctgcagctgataaataaccagctgagggaagag
gacgacaaatggcaagatgacctggctcgctggaagagccgtcgaagaagcgcttcccag
gacttaatcaagaaagaggaagaaaggaaaaaaatggagaagttgatgtctggagaagat
gggacaagtgaacggaggaaaagcatcaaaacttacagagaaattgtccaagaaaaggag
cggagagagagggagctgcacgaggcatataagaatgcaaggtcacaggaggaggcagag
gggatcctccagcaatacatcgagaggttcaccatcagtgaggctgtcctcgaacgcttg
gagatgccaaaaattctggaaagaagccattcaacagagccaaacgtatcctccttcccc
aacgaccccagccccatgaaatacttgcgtcagcagtcactgcccccgcccaagttcact
gccacggttgagactaccatcgctcgcaccagtgtcccagagagcagcgtagcagcaggc
actgggtctccaagcaaaaccagcactccaaacacggtgcctatgctgacacccaggcct
tactcccagcccaaaaactctcaagaggttctgaagacttttaaggtcgatgggaaagtc
agcatgaatggagaaacggcccgtggagatgtggaaggaaaggaaaaagaagaccccaca
gcggtggcccctggcccttccttaaccaagtcccagatgtttgaaggcgtggccacggtg
catggctctcccgtgcaagtgaaacaaggcagcaacagcatcgagatcaacatcaagaag
ccaaattctcctccccaggaactgacagcagcctctgaggaaactgagtcaaacggccga
gatgatgagaacggtgaagagagctcaggggcacgggatgtggagctggattcggcagag
ccacagcattttacaacaaccgtgactcggtgcagcccaaccgtggccctggtggagttt
tcttccagcccgcagctgaggaatgaagtaccagaagaacaagaccagaagaagccagaa
aacgagatgagcgggaaggtggagttagtactgtcccagaaggtggcaaagccaaaatcc
ccagaaccggaagcaaccttgacatttccatttcttgacaaaatgcctgaaaccgaccaa
ctacatttgccaaatctcaattctcaagcggattccccaagcagtgagaagtcccccgca
agcacgccttttaagttctgggcgtgggacccggaagaggagcgtaggcgacaggagaag
tggcagcaggagcaagagcgcctgctccaggagaggtatcagaaggagcaggataagctg
aaggaggaatgggaaaaggcccagaaggaggtagaagaagaggaacgcagatactatgag
gaggagcgtaagataattgaggacaccgtggttccattcactatttcctcgagttctgcc
gaccagctgtctacatcctcatctgtaactgaaggcagcgggacaaggaataagatggac
ttggaaaactgccaagacagagacaaagagagaagacagaacactcccctccaggagaat
gacagtgactcatcactcaaagctagagaaagtggcctgcccgaggagcacagcagccta
actcaaagtccctcagctaactctgaaaactccgtgtcaaaaggaattagtcaggaccag
cagccagagacagaggctgaggcctcacactgtggtacaaacccacagtcagctcaggat
ccaccttggaatcaacagatctcaaacccaccgacatccaagtcggaagacgtgaagccc
aaaaccctagccctggagaaaagcattaatcatcagattgagtctccgggggaaaggcgg
aagaaaagccctcgagagaacttccgggctgggcccctgtccccctgctctcctacccct
cctggccagtctccaaacaggtctataagcgggaagaagctgtgctcctcctgtgggctt
gctttggggaaaggcgccgcaatgatcatcgagactctgaatctctactttcacatacag
tgtttcaggtgcggcatttgtaaaggacagctaggagatgcagtgagtgggacagatgtc
aggattcgcaacggtcttctaaactgtaccgactgctacatgcgatccagaagtgctggc
cagcctacaacactgtga

DBGET integrated database retrieval system