KEGG   Rattus norvegicus (rat): 305343Help
Entry
305343            CDS       T01003                                 

Gene name
Pds5a, RGD1307094, Scc-112
Definition
(RefSeq) PDS5 cohesin associated factor A
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    305343 (Pds5a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    305343 (Pds5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 305343
NCBI-ProteinID: NP_001077093
RGD: 1307094
Ensembl: ENSRNOG00000002541
UniProt: A4L9P7
Position
14p11
AA seq 1333 aa AA seqDB search
MDFTQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSED
EKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFIT
RQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNK
KVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIEA
CIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERLA
VVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDL
TEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMMG
LAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETE
ERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMT
IAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANPK
QPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDSAIRSGLE
LLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTLI
PILHQKAKRGTPHQAKQAVHCIHAIFSNKEVQLAQIFEPLSRSLNADVPEQLITPLVSLG
HISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIKL
LVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQ
EPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPV
KERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDV
DQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDEAKTNEKLYTVCDV
ALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFSNDKSYISEETRVLLLTGKPKPTGVL
GTVNKPLSATGRKPYVRSAGTETGSNINASSELSPSAGNRSREQSSEASETGVSENEENP
VRIISVTPVKSIDTVKNKEINSDQSTQGNISSDRGKKRIVTAAGAENIQQKPDEKADESG
PPAPSKPRRGRRPKSESQGNATKNDDLSKPVSKGRKRAAGSQESLEAGNAKAPKLQDGAK
KAVPAERQIDLQR
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atggacttcacgcagccgaagcctgccacggccctctgtggcgtcgtgagtgcggacggg
aagatcgcttaccctccgggagtaaaagagatcacggacaagatcaccaccgacgaaatg
atcaaacgtttgaagatggtagtgaaaacttttatggatatggatcaggattcagaagat
gaaaaacaacagtatctcccactagccttgcatcttgcatctgaattctttctcaggaac
cctaataaagatgtgcgccttcttgtagcttgttgtttggctgatatatttcgaatctat
gccccagaagctccatacacttcccacgataaacttaaggacatatttctctttattacc
agacaattaaaaggtttggaggatacaaagagtccacagtttaatagatatttttattta
ttagagaatttagcttgggttaaatcatataacatctgctttgaattggaagattgcaat
gaaatttttattcagctttttaggactctcttctcagtaatcaacaatagccacaataag
aaggtacaaatgcacatgttagacttgatgagttctatcatcatggaaggtgatggagtt
actcaagaattattggattccattcttatcaatctcatccctgcacacaagaacttaaat
aaacagtcctttgaccttgcgaaagttctgttgaaaaggacagtccagactattgaagca
tgtattgccaattttttcaatcaagtgctggtgctgggcagatcatcagtcagtgatctc
tccgaacacgtatttgatctgattcaggaactttttgctatagatcctcatttattgtta
tctgtcatgccacagcttgaattcaaactgaagagcaatgacggtgaggagcggctagct
gtggtgcgactactagcaaaattgtttggctctaaagattcagatttagcaacacagaat
cggcctctttggcagtgctttcttgggcgatttaatgacattcatgttcctgtgaggtta
gaaagtgtgaagtttgccagtcactgtttaatgaatcaccctgatttagcaaaagatctc
acagaatatttaaaagttaggtcacatgatccggaagaagccattcgtcatgatgtcatt
gttactataataacagctgccaaaagagaccttgccttagtaaatgatcagttgcttggc
tttgtcagggaaaggacactggataaacggtggcgagtaagaaaagaagccatgatgggt
ctggctcaactctataagaaatactgtcttcatggtgaagcaggaaaggaagctgcagag
aaagtcagttggataaaggacaaacttctacacatctattatcagaatagcattgatgac
aaactgttggtagagaaaatctttgctcagtatcttgttccccataacctggaaacagaa
gagagaatgaaatgcttatattatttatatgctagcttggatccaaatgctgtaaaagct
ctcaatgaaatgtggaagtgtcagaatatgcttcggagtcacgtgcgggaactgttggac
ttgcacaagcagcctacatcggaggctaactgttctgccatgtttgggaaactgatgacc
atagcaaagaatttgcctgaccctgggaaagcacaagattttgtaaagaaatttaaccag
gttcttggtgatgatgaaaaactgaggtctcagttggaattattaatcagcccaacctgt
tcatgcaagcaagctgacatttgtgtgagggaaatagctcggaaacttgcaaatcctaag
cagccaaccaacccctttctagagatggtcaagtttctgctggaaagaatcgctcctgtg
cacattgattcagaagccataagtgcactagtgaaactgatgaacaagtcgatagaaggg
acagccgatgatgaagaggagggtgtcagtccagactcagccattcgctcagggcttgag
cttcttaaggttctgtctttcacacatcctacctcgttccactctgcagagacgtatgag
tccttgttacagtgcctaagaatggaggacgacaaggtagcggaagcagcaatacagatt
tttagaaacacaggccacaaaatagagactgaccttccccagatacggtcaaccttgatc
cccattttacatcagaaagccaagcggggcactcctcaccaagcaaagcaggctgtgcac
tgcatccatgccatcttctcaaacaaggaagtccagttggcacagatttttgagccactc
agtcggagtctgaatgctgatgtaccagagcaacttataactccattagtttcactgggc
cacatttccatgttagcaccagatcagtttgcctccccaatgaaatctgtagtggcaaac
ttcattgttaaggatcttctaatgaatgacaggtcaacaggtgagaagaatggaaaatta
tggtctccggatgaggaagtatctcctgaagtgctagcaaaggtacaggcaattaaactt
ctggtaaggtggctgttgggtatgaagaacaatcagtccaaatctgccaactcaactctg
cggctgttatcagccatgctggtcagtgagggggacctgacagagcagaagaggatcagt
aaatctgatatgtctcgcttgcgattagctgctggtagtgccataatgaagcttgctcag
gaaccttgctaccatgaaattattaccccagaacagtttcagctctgtgcactggttatt
aacgatgagtgctaccaagtaaggcagatatttgcccagaagcttcataaagcccttgtg
aagttacttctcccattggagtatatggcgatctttgctttgtgtgccaaagatcctgtg
aaggaaagaagagcacatgctcgccagtgtttattaaagaacatcagcatacgcagggag
tacattaaacagaaccccatggctactgagaagttattatcattgctgcctgaatatgtg
gttccatatatgattcacctgctagcccatgatcctgattttacaagatcacaagatgtt
gatcaacttcgtgatataaaagagtgcctgtggtttatgcttgaagttttaatgacaaag
aatgagaacaacagccatgcattcatgaagaagatggcagagaatatcaagctgaccaga
gacgcccagtctccagatgaagccaagacaaatgaaaaactttatacagtttgtgatgtg
gctctgtgtgttataaatagtaagagtgctttgtgcaatgcagactcaccaaaggaccca
gtcctcccaatgaaattctttacacaacctgaaaaggacttctctaatgacaaaagctat
atttcggaagagacaagagttcttctgttgacaggaaagccaaagcctactggagtacta
ggtacagtaaacaagcccttatcagcaacgggaaggaagccttatgttaggagtgccggc
acagagactggaagcaatattaacgccagttcagagctgagtccttcggccggaaatcgt
tcaagggaacagagttcagaggcatcagaaactggagttagtgaaaatgaggagaatcct
gtgagaataatttctgtcacacctgtaaagagtattgatacggtaaagaataaggaaatt
aattctgatcagtctacccaaggcaacatcagcagtgaccgaggaaagaaaagaattgta
acagcagctggtgctgagaatatccaacaaaaaccagatgagaaagcagatgagtcagga
ccccctgccccttccaaacccaggagaggacgtcgccccaaatctgaatctcagggcaat
gcaaccaaaaacgatgatctaagtaaacctgttagcaagggaaggaagagagctgcaggc
agccaggagagtctggaggcaggcaatgccaaagcgcccaagctacaagatggagccaaa
aaggcagttcccgccgagagacaaattgatttacaaaggtaa

DBGET integrated database retrieval system