KEGG   Rattus norvegicus (rat): 305353Help
Entry
305353            CDS       T01003                                 

Gene name
Tlr6
Definition
(RefSeq) toll-like receptor 6
  KO
K10169  toll-like receptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04620  Toll-like receptor signaling pathway
rno05142  Chagas disease (American trypanosomiasis)
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    305353 (Tlr6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    305353 (Tlr6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    305353 (Tlr6)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    305353 (Tlr6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305353 (Tlr6)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    305353 (Tlr6)
   04090 CD molecules [BR:rno04090]
    305353 (Tlr6)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    305353 (Tlr6)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   305353 (Tlr6)
CD molecules [BR:rno04090]
 Proteins
  305353 (Tlr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_6 LRRCT
Motif
Other DBs
NCBI-GeneID: 305353
NCBI-ProteinID: NP_997487
RGD: 1303030
Ensembl: ENSRNOG00000002161
Vega: OTTRNOG00000001104
UniProt: Q6P690
Position
14p11
AA seq 806 aa AA seqDB search
MVKSLWDSLCNMSQDREPIVESFHFVCTLALIVGSMTQFSDELESVVDYSNKNLTHVPKD
LSPSTKSLSLSQNSISDLQMSDISFLSELRVLRLSHNRIRRLDFGVFLLNRDLEYLDVSH
NQLQNISCCPMVNLKHLDLSFNDFEVLPVYKEFGNLRKLSFLGLSAAKFRQLDLLPISHL
HLSCVLLDLVNYQIKDGETESLQVPNTNVLHLVFHPNSLFSVQVNISVNALGCLQLSNIK
LNDENCQSLIIFLSELTRGPTLLNLTLQHIETNWKCFVRLLQFLWPRPVEYLNIYNLTIT
ESISRETFIYVETVLKSLKIEHVTNQVFLFVKDALYSVFAEMNIRMLTLSDTPFIHMVCP
EFPSTFAFLNFTQNVFTDSIFQGCSTLKRLETLILQRNGLKNLFKVALMTKTMSSLETLD
VSLNSLNSHVYDRTCAWAESIRVLNLSSNVLSDSVFRCLPPKVKVLDLHNNRIVSIPKDV
THLQALQELNVASNFLTDLPGCGAFSSLSVLVIDHNSVSHPSSDFFQSCQNIRSITAGNN
PFRCTCELREFVKNIGQASREVVEGWPDSYRCDYPDSIKGTPLQDFHMSPLSCDTILLTV
TIGATLLLLAAIGASLCLYFDLPWYLRMLWQWTQTRHRARNIPLEELQRNLQFHAFVSYS
EHDSAWVKNELLPNLEKDDIRVCLHERNFVPGKSIVENIIHFIEKSYKSIFVLSPHFIQS
EWCHYELYFAHHNLFHEGSDNLILILLEPIQQNNIPSRYHKLRALMAQRTYLEWPIEKGK
RGLFWANLRASFIMKLALVNENDVKT
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatccctctgggatagcctctgcaacatgtcccaagacagagaacccatcgtg
gagagtttccattttgtttgcaccctggccttaatagtcggaagcatgacccagttctct
gatgaacttgagtctgtagtagactattcaaacaagaaccttactcatgtcccaaaagac
ctgtcaccaagcacaaaatccttgagtctgtctcaaaactccatatctgatcttcagatg
tctgatatcagctttctgtcagagctgagagttctgagactctcccacaacagaatacgg
agacttgactttggtgtgttcttgctcaatcgggacttagaatacctggatgtctctcac
aatcagttacaaaacatctcttgctgtcctatggtgaacttgaaacatctagacctctca
ttcaatgattttgaagtgctgcccgtgtataaggaatttggcaacttgaggaagctgagt
ttcttgggattaagtgctgcaaagttccgacaactggatctgctcccaatttctcacttg
cacctgagctgtgttcttctggacttggtgaattatcagataaaagatggtgaaacagaa
agtcttcaggttccaaataccaacgttctccatttggtctttcatccgaatagcctgttc
tctgtgcaagtgaacatatctgtaaatgctttaggatgcttacaactgagtaatattaaa
ttgaatgatgaaaactgtcaaagcttaattatatttttatcagaactcaccagaggtcca
accttattgaatctgaccctccagcacatagaaacaaactggaagtgctttgttagactt
ttacaattcctttggcccagacctgtggagtatctcaatatttacaacttaacgataact
gagagcataagcagggagacatttatttacgtggagacagtgttgaagtcactgaagata
gagcatgtcacaaaccaagtgttcctctttgtgaaggatgcactatattctgtgtttgca
gaaatgaacatcaggatgctcacactgtcagacacgccattcatccacatggtgtgccct
gagttcccaagcacatttgcatttctgaactttacccagaacgtttttactgacagcatt
tttcaaggctgttccaccttgaagagactggagacacttatcttgcaaaggaatggttta
aagaacctttttaaggtagctctcatgaccaagactatgtcctctctggaaacattggat
gtcagtttgaattctttgaactctcatgtgtatgacagaacatgtgcttgggccgagagc
atacgggtgttgaatttgtcttcgaatgtactttcggactctgtcttcaggtgcttacct
cccaaggtcaaggtccttgaccttcacaacaacaggatagtgagcatccctaaagatgtc
acccacctgcaagctttgcaggaactcaatgtcgcatccaattttttaactgaccttcct
ggatgtggagccttcagtagcctttctgtgctggtcatcgaccataactcagtttcccac
ccctcctctgatttcttccagagctgtcagaatatcaggtccataacagcggggaacaac
ccattccgatgcacatgtgagctgagggagtttgtcaaaaacataggtcaggcatcaaga
gaagtggtggagggctggcctgactcttacagatgtgattacccagacagcattaaggga
accccactgcaggacttccacatgtctccactgtcctgcgatacaattctactgactgtc
accattggggccactctgctgctactggctgccattggggcttccctctgtctctacttt
gatctgccctggtatctcaggatgctatggcagtggacacagaccaggcacagggccagg
aacatccccttagaggaactgcagaggaacctccagttccatgcttttgtctcatacagt
gagcatgattctgcctgggtgaagaatgaattactaccaaacctagagaaagatgacatt
cgggtttgcctccatgagagaaactttgtccctggcaagagcattgtggagaacatcata
cacttcattgagaagagttacaagtccatctttgtgctgtctccccacttcatccagagt
gagtggtgccattatgaactctactttgcccatcacaatctcttccacgaagggtctgat
aacttaatcctgatcttgctggaacccatccaacagaacaacattcccagtagataccac
aagctgagggctctcatggcacagcggacttacttggaatggcctattgagaagggtaaa
cgtgggctgttttgggccaaccttagagcttcttttattatgaagctagccttagttaat
gagaatgatgtgaaaacttga

DBGET integrated database retrieval system