KEGG   Rattus norvegicus (rat): 305428Help
Entry
305428            CDS       T01003                                 

Gene name
Zbtb49, Zfp509, Znf509
Definition
(RefSeq) zinc finger and BTB domain containing 49
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-C2H2 zf-C2H2_jaz zf-met zf-C2H2_4 DUF285
Motif
Other DBs
NCBI-GeneID: 305428
NCBI-ProteinID: NP_001100693
RGD: 1306733
Ensembl: ENSRNOG00000005633
UniProt: D4A8F0
Position
14q21
AA seq 430 aa AA seqDB search
MDPVAIHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAAFSQYFRSLFQNSSSQ
KNDIFHLDVKNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCLQVQNVLNLCHTFLKSA
SAAPLPGLPCAGGFSLQGVSLDGTCAAASEHYPPHSLQDCPMEGPRAKDVSRGNPRAPPA
DFGRPTGEGSKPAAASGSCPEAPRKQPNCYYKLRTLYSKQYYKQTACPSPVPATEQPPTP
RASTDLAAADSQPPVEGRAGVPESPEHLASTVVAPPVRSSGIDSEADTLSQPPAKQMRLK
KAMHLKKLNFLKSQQSAECTSHPQSDNVLVRGEESAAKEDAGERAGSQTTEDKGREELGP
ESSREVEMPGAPASWEDPSQALQSQKQYACELCGKPFKHPSNLELHKRSHTGRQPSDSLT
PALWGEAIHL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgttgctattcatagctgccacctcctccagcagctgcgagagcagcggatc
cagggcctgctttgtgactgcatgctggtggtgaggggcgtgtgcttcaaagcacacaag
aatgtgctggcagccttcagccagtatttcaggagtctttttcagaactcttccagccag
aagaatgacatctttcacctggacgttaaaaacgtcagtggcatcgggcagatcctggac
ttcatgtacacgtcgcgcctcgaccttaaccaggacaacattcaggtgatgctggacaca
gcgcagtgtttgcaagtgcagaacgttctgaatctgtgccacacgtttctgaagtcggcc
tccgcggcaccgctgccaggcttgccttgtgctggcggtttctccctgcagggtgtgagt
ctggacggcacctgcgcggcggcgagtgagcactacccccctcactcactgcaggactgc
cctatggaaggcccgcgggctaaagacgtgtccagagggaatccccgtgctccaccagca
gatttcggtcgtcccacaggagaagggtcaaaaccagctgccgcaagtggcagctgccca
gaggcgccccgcaaacagcccaactgctattacaaactcagaacactgtacagcaagcag
tactacaagcaaactgcctgccccagtccggtgcctgccacagagcagccgcccactccc
cgtgcctccacagacctcgctgcagcagactcacagccgcctgtggagggccgtgcaggg
gtcccggagtctccagagcacttggcttccactgttgtggctccaccggtcaggagctct
ggcatcgactcagaggcagacaccctttctcagccacctgccaagcagatgaggctgaag
aaggccatgcacctgaagaaactaaactttcttaagtcacagcagtcagctgagtgcact
tcacatcctcagtcagataatgtgttagtcaggggggaggaatctgctgctaaggaagat
gcaggggaaagagccggaagccagacaactgaagacaaagggagggaagaactgggtcca
gagagcagccgcgaggtggagatgccaggagccccagcttcctgggaagacccgtcccag
gccctccagtcccagaaacagtatgcgtgtgaattgtgtgggaagccttttaaacaccca
agcaatctggagctgcacaaacggtctcatacaggcaggcaaccttcagactcacttacg
ccggcactctggggagaagccatacatctgtga

DBGET integrated database retrieval system