KEGG   Rattus norvegicus (rat): 305454
Entry
305454            CDS       T01003                                 

Gene name
Zfyve28
Definition
(RefSeq) zinc finger FYVE-type containing 28
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FYVE
Other DBs
NCBI-GeneID: 305454
NCBI-ProteinID: NP_001100697
RGD: 1310151
Ensembl: ENSRNOG00000014874
UniProt: D3ZTZ1
Position
14q21
AA seq 905 aa
MMNRFRKWLYKPKRSDPQLLAQFYYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQ
DNVLNIINQIMEECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELE
SMAMRPLAKELTRSLEDVRGTLRDQALRDLNTYTEKMREALRRFDVLFAEFELSYVSAMV
PVKSPREYYVQQEVIVLFCETVERALEFGYLTQDMIDDYEPALMFTIPRLAIVCGLVVYA
DGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQALTEEELHTLERSLCVSQDVELPIRADA
QAPSALAPSFSASLAPEETLSASANNPEEELACSMQYDDQELEELSRMVHRAGDEMSSLL
SPPSACQSPAHRAGSEASPRGEASPARAQLKSGSDEEERVFFMDDVEVTESPARPESPRS
TFELTQGNVQQRGQDGQSGEVGVRAPALVKEEDWSNNNIEGDKIKLASLAGSTSCSCLDS
QLYLDGWEVSAEDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAAASQEVPGHSISPL
EPRAEGTGDNTHKLSTTATNCLLHSCVCCGSCGDSREDAVECLREKCGPGSVLSASNPSV
SLAKGGEKEPERLEEAQPSDVTLPAEDASSRQEPKAPASNKCLAHTSGPQVDTASRLQGE
SEVKGQPEPEARKQDSEKSPVVSGDSPRGDTAQTEPQHLSGSSSTTGSCSLDSTRLEVTT
AVMPVTPMATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMAT
KPETDDKEKLKKVTQSLRSAALEDCALCQETVSSSELAAKTRDGDFEDPPEWVPDEACGV
CTSCKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYS
DKTGM
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgatgaacagattccgaaagtggctgtataaacccaagaggtcagacccacagctgctg
gcccagttctactatgccgatgaggagctgaaccaggtggctgcagagctagacagcctg
gatgggcggaaggagccccagaggtgcacactgcttgtcagccagttccgctcctgtcag
gacaatgtgttaaacatcattaatcagatcatggaggagtgtatcccccaggaccgagcc
cctcgggatttctgcgtcaagtttccagaggagatccggcacgacaacttggctggccag
ctgtggttcggggctgagtgcctggcagctggctccatcatcatgaatcgtgagctggag
agcatggccatgcggccgctggccaaggagctgacgcgcagcctggaggatgtgcggggc
actctccgtgaccaggcactacgagacctcaacacctacacggagaagatgcgggaggcg
ctgagacgctttgatgttctgtttgccgagtttgaactgagctatgtctcagccatggtg
ccagtgaagtcccccagggagtactatgtgcagcaggaggtcatcgtgctgttctgtgag
acggtggagagagccttggagtttgggtatctgacccaggacatgattgacgactatgag
cctgctctcatgttcaccattcctcggctggccattgtgtgtggccttgtggtctatgca
gatggacccctgaacttggaccgaaaggtggaggacatgtctgagctgttccggcccttc
cacacgttgctgcggaaaataagggatctgctgcaggcactgactgaggaggagctgcac
accctggagcggagcctctgcgtgtctcaggatgtggagcttcccatccgggcagacgcc
caggcacccagtgccctggcaccctccttttctgcatcccttgcccccgaggagacactt
tccgccagtgccaataacccagaggaagagctggcctgctcgatgcagtatgatgaccag
gagctggaggagctcagccgcatggtccacagggccggggatgagatgtcttctctgctt
tcaccgcccagtgcctgtcagtccccagcccatagggcaggctcagaggctagccctcga
ggagaggcctctccagccagagcccagctgaagtcgggcagcgatgaggaggaaagggtg
ttcttcatggatgatgtggaggtgacagagtctcctgccaggcccgaatccccaaggagc
acatttgagttgacgcagggtaatgtccaacagagaggacaggatggccagagtggagag
gtgggggttagggcacctgccctggtaaaggaggaagactggagcaacaacaacattgaa
ggtgacaagataaagctggccagcctcgcgggctccacttcctgcagttgcctagactca
cagctatacctggatggctgggaggtgagcgcagaggatgccgagactgcagaaatgatt
gcacaccggaccgggggaatgaagctgtcggccacagtcatcttcaaccccaagtctcca
acctccttggactcagctgcggcaagccaagaagtcccgggccatagtatttccccattg
gagcccagggccgaggggacaggggacaatacacacaaactcagcactacagccaccaac
tgcctcctccactcctgtgtgtgctgtggcagctgtggggacagcagggaggatgctgta
gagtgcctacgggagaagtgtggcccaggaagtgtcctcagtgcctctaacccttctgta
agcttagccaagggtggtgaaaaagagcctgagagactagaggaggcccagccttctgat
gtcaccctgcctgcagaagatgcctccagtaggcaggagcccaaagcccctgcttccaac
aagtgcctggcacacacctcagggcctcaggtggacacagcaagcaggttgcaaggagag
agtgaggtcaaaggccagccagaaccagaggccagaaagcaggactctgagaagtctcct
gtggtcagtggggacagtccaagaggggacacggcccagacagaaccccagcacctgtcg
ggctccagctccacgactggttcctgctccttagacagcaccaggttggaggtgaccact
gcagtcatgcctgtcacccccatggccaccagagagaagatccggtccaggttccatggc
agccatgacctgatccaccgcctatttgtctgcatttcaggtgtagctgaccagctgcag
acgaactatgctagcgacctaagaagtattctcaaaacactgtttgaggtcatggccaca
aagccagaaacagatgacaaagagaagctaaagaaggtaacccagagcctgcggagcgcg
gccttggaagactgtgcattgtgccaggaaactgtgtcatcctcagaactggcagccaag
acccgagatggggactttgaagaccctcccgagtgggtgccagatgaggcctgcggcgtc
tgcacctcctgtaaagctcccttcaccgtcatccgcaggaagcaccactgtcgcagctgt
gggaagatcttctgttcccgctgctcatcacactcagcaccacttccgcgctatggccag
gtgaagcctgtccgtgtgtgcacgcattgctacatgttccacgtcacgcccttctacagt
gacaagacgggcatgtga

DBGET integrated database retrieval system