KEGG   Rattus norvegicus (rat): 305457
Entry
305457            CDS       T01003                                 

Gene name
Letm1
Definition
(RefSeq) leucine zipper and EF-hand containing transmembrane protein 1
  KO
K17800  LETM1 and EF-hand domain-containing protein 1, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    305457 (Letm1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    305457 (Letm1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    305457 (Letm1)
Transporters [BR:rno02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   305457 (Letm1)
SSDB
Motif
Pfam: LETM1 EF-hand_8 EF-hand_1 SAP Acetyltransf_11 DUF4335
Other DBs
NCBI-GeneID: 305457
NCBI-ProteinID: NP_001005884
RGD: 1359678
Ensembl: ENSRNOG00000016427
UniProt: Q5XIN6
Position
14q21
AA seq 739 aa
MASILLRSCRGRGPARLASPRAASPRGSLRDRACLSCTRTVGLTSHESVLSRCCTPANPV
YLYFKSEPLSCWTQRPECQGTVARAAWTPASARLVVTGPQYLPVRGWHSSSPLGEDSMIE
KSLKSLKDKNKKLEEGGPVYSPPAQVVVKKSLGQKILDELKHYYHGFRLLWIDTKIAARM
LWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVVVKLFPNMLPSTFE
TQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGNATKDFSAFFQKIRETGERPS
NEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKL
ISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQWLDLHLYHEIPTSLLILSRAM
YLPDTLSPADQLKSTLQTLPEIVAKEAQVKAAEVEGEQVDNKAKLEATLQEEAAIQQEHL
EELKRAAETAKDIQPEVAEATVPGRPGAELQPKMVDVIPPSEILKDTAPVLEGLKGEEIT
KEEIDILSDACSKLKEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGDEKYIEE
STASKRLSKRVQQMIGQIDGLITQLETTQQNGKLDPAAASSPTGESVISVDELISAMKQI
KHIPEHKLISLTSALDENKDGNINIDDLVKVIDLVNKEDVQISTTQVAEIVATLEKEEKV
EEKEKAKEKAEKEAAEVKN
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggcgtccatcttgctcaggagctgccgcggccgggggcctgcccgcctcgcgtcgccc
cgggccgcttccccgcggggtagtctgagggatcgagcttgtctcagttgtaccaggacc
gtggggttgacgagccatgagagtgttctgtcccgctgttgtactccagccaaccctgtg
tacctctacttcaaaagtgagcccctcagctgttggactcagaggcctgagtgccagggc
accgtggcaagggcagcatggacacctgcctctgcgaggttggttgttacgggacctcag
taccttcctgtgcgtggctggcactcatcatccccactaggagaggactctatgatagag
aaatcccttaagtctttaaaggacaagaataagaagctggaagaaggtggccccgtgtac
agcccgccagctcaggtggtagtgaagaagtccctggggcagaagatactggatgagctg
aagcactactaccatggcttccgcctgctgtggatcgacaccaagatagccgcccgtatg
ctgtggcgcatcctgaatggccatacgctgacccgccgggagcgcaggcagtttctccgg
atttgtgcagacctcttccgtctagtacccttcctggtgttcgtggtggtacccttcatg
gaattcctgctgcctgtagttgtgaagctcttccccaatatgctgccctccacatttgag
acccagtctatcaaggaggaaaggctgaagaaggagcttagggtgaagctggagctagcc
aagtttctccaagacaccatagaggaaatggccctgaagaacaaggcagccaaagggaat
gccaccaaggatttctctgcctttttccagaagatccgggagacaggggagagacccagc
aatgaagaaatcatgcgtttttccaaattatttgaggatgaactgaccctggataaccta
acgaggcctcaactggtagcactgtgcaagctgctggagcttcagtccattggtaccaac
aacttcttgcgtttccagctcaccatgcggctgaggtctataaaggctgatgataagctg
atttctgaggaaggggtagacagtctgactgtgaaggaattgcaggcagcgtgtcgagca
cggggcatgcgagcacttggtgtcacagaagaccgtctgaagggccagctgaaacagtgg
ctggacttgcacctgtatcacgagatccctacatcattgctcatactgtcccgggccatg
tacctcccagacaccctctcacctgccgaccagctgaagtccaccttgcagacccttcca
gaaattgtggcaaaggaggctcaggtaaaagcggctgaggtggagggcgaacaggtagac
aacaaggcgaagctggaggccacactgcaggaagaggccgccatccagcaggagcacctg
gaagaactaaagagagccgctgagactgcgaaggacatccagccagaagtagcagaagcc
actgtccctgggaggccaggcgccgagcttcagcccaagatggttgatgtgatcccgccc
tcagagatactaaaggatacagcacctgttctggaaggtttgaagggagaagagataacc
aaggaggaaattgacatcctcagtgacgcctgctccaagctaaaggagcagaagaagtcc
ctgaccaaggagaaggaggagctggagctgctgaaagaggatgtccaggactacagtgag
gacttgcaggagatcaagaaggaactttccaagacgggtgatgagaaatacatagaagag
tctacagccagcaagaggctgtccaagcgggtgcagcagatgatcgggcagatcgatggc
ctcatcacacagctggagaccacgcaacagaacggcaagctggaccccgctgctgcgagc
tctcccacaggggagagtgtcatcagcgtcgacgagctcatcagcgccatgaagcaaatc
aagcacattccagaacacaagctgatcagtttgacctcagccctggatgaaaataaggat
ggcaatatcaacatcgatgatcttgttaaggtaatcgacttggtgaacaaagaagatgtc
cagatctctaccacccaggtagccgagattgtggccacactagagaaggaagaaaaggtg
gaagagaaggaaaaggccaaggaaaaggctgagaaggaggcggcagaagtgaagaactag

DBGET integrated database retrieval system