KEGG   Rattus norvegicus (rat): 305502
Entry
305502            CDS       T01003                                 

Gene name
Tmed4, RGD1306319
Definition
(RefSeq) transmembrane p24 trafficking protein 4
  KO
K20346  p24 family protein alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305502 (Tmed4)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    305502 (Tmed4)
SSDB
Motif
Pfam: EMP24_GP25L SdrD_B CarboxypepD_reg
Other DBs
NCBI-GeneID: 305502
NCBI-ProteinID: NP_001100708
RGD: 1306319
Ensembl: ENSRNOG00000005016
UniProt: A0A0G2K8M5
Position
14q21
AA seq 168 aa
MWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNST
RMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRY
REERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtgggacaagcagaaagaggtcttcctgccatcgacccccggcctgggcatgcatgtg
gaggtgaaggacccagacggcaaggttgtactgtcccggcaatacggctccgagggccgt
ttcacgttcacttcccacacacccggtgaccatcagatttgtctgcactccaactccacc
aggatggctctcttcgctggaggcaaactgcgtgtacacttggatatccaggttggggag
catgccaacaactaccctgagatcgctgctaaggataagttaacagagctacagcttcgt
gctcgccagttgcttgaccaggtggaacagatccagaaggagcaggattatcagaggtat
cgtgaagaacgcttccgtctgaccagtgagagcaccaaccagagggtcctgtggtggtcc
atcgcccagaccgtcatcctcatcctcactggcatctggcagatgcgtcatctcaagagc
ttctttgaggccaagaagctggtgtag

DBGET integrated database retrieval system