KEGG   Rattus norvegicus (rat): 305505Help
Entry
305505            CDS       T01003                                 

Gene name
Ccm2
Definition
(RefSeq) CCM2 scaffolding protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CCM2_C PID ICAP-1_inte_bdg DUF1722
Motif
Other DBs
NCBI-GeneID: 305505
NCBI-ProteinID: NP_001119747
RGD: 1308067
Ensembl: ENSRNOG00000060825
UniProt: B1H273
Position
14q21
AA seq 453 aa AA seqDB search
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLALPERVEPDRLLS
DYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDKAKRSHQLPGHLTQEHDAVLSLSAYNV
KLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAEGSRGLSAG
SLSESAVGPVEACCLVIMATESKVAAEELCSLLSQVFQIVYTESTIDFLDRAIFDGASTP
THHLSVHSDDSSTKVDMKDSYDADASTFCFPDSGDVGGLPPLPFCMQASPHSKTVSESEL
STSATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCISLRQLYGDSRKFLLL
GLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSTSTTNGNRTTGSPDD
RSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagggcaagaagggcaagaagcctggaattgtgtcgccgtttaaacgagta
ttcctaaaaggtgaaaagagtagagataagaaagcccatgagaaggtgacagagaggcgc
cctctacacactgtggtgctggccttgcctgagcgagtcgagccagacagactgctgagc
gactatattgagaaggaggtgaagtatttagggcagttaacatccattcctggctacctg
aacccttccagtaggacggaaatcctgcatttcatagacaaggcaaagcggtcccaccaa
ctccctgggcacctgactcaggagcatgatgctgtgctcagtctgtccgcctacaatgtc
aagctggcctggagggatggggaggacattatcctcagggtgcccatccacgacatcgct
gctgtctcctatgtccgagatgatgctgcacacctggtggtcctgaagacagcccaggac
ccaggcatctctcccagccaaagtctgtgtgcggaaggttctagaggcctcagcgcaggc
tccttgtcagaaagtgcagtggggccagtagaggcctgttgcctggtcatcatggccaca
gagagcaaggtcgccgctgaagaactgtgctccctgctcagccaggtcttccagatcgtc
tacacagagtccaccatcgactttctggaccgagcaatattcgacggggcctccacccct
acccaccacctgtcagtgcacagcgatgactcttccacgaaagtggacatgaaggacagt
tatgacgccgacgccagcaccttctgcttcccggactctggggatgtggggggcttgccg
cccttgcccttctgcatgcaggcatccccccacagcaagacggtcagcgagagtgagctg
agtaccagcgccacggagctgctgcaggactacatgctcacgttacgtaccaagctgtca
tcacaggagatccagcagtttgcagccctgctgcatgaataccgcaacggggcctccatc
catgagttctgcatcagcctgcggcagctctatggagacagccgcaagttcctgctgctt
ggtctgaggccctttatacctgagaaggacagtcagcactttgaaaacttcctggagacc
attggcgtgaaagacggccgtggcatcatcactgacagctttggcaggcatcgccgtgct
ctgagcaccacctccacatccaccaccaatgggaacaggaccacaggcagccctgatgac
cgctcagcgccctcagagggggatgagtgggaccgcatgatctcagacatcagcagtgat
attgaagcactaggctgcagcatggaccaggactcagcgtga

DBGET integrated database retrieval system