KEGG   Rattus norvegicus (rat): 305539
Entry
305539            CDS       T01003                                 

Gene name
Spred2
Definition
(RefSeq) sprouty-related, EVH1 domain-containing protein 2
  KO
K04703  sprouty-related, EVH1 domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    305539 (Spred2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     305539 (Spred2)
SSDB
Motif
Pfam: Sprouty WH1
Other DBs
NCBI-GeneID: 305539
NCBI-ProteinID: NP_001040559
RGD: 1309304
Ensembl: ENSRNOG00000004888
UniProt: Q3C2P8
Position
14
AA seq 410 aa
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREPNTRTISSPTSCEHRRIYTL
DPYPMDLYHPDQRLPRSYPQVTFPEDDEEIVRINPREKIWMTGYEDYRHAPVRGKYLDST
EDADSYVRFAKGEVPKHEYTYPYVDSSDFGFGEDPKGNVIKTQPPRAKSRRRKENGERSR
CVYCRDMFNHEENRRGHCQDAPDAVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCSCD
TSDEKFCLRWMALIALSFLAPCMCCYLPLRACHHCGVMCRCCGGKHKAAA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaccgaagaaacacacccggacgatgacagctatattgtgcgtgtcaaggctgtggtt
atgaccagagatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgc
gtcggggtgtgtaaggtcatgcaccctgaaggcaacggacggagcggctttctcatccat
ggcgaacgacagaaagacaaactggttgtattggaatgctatgtcagaaaggacttggtc
tacaccaaagccaatccgacgtttcaccattggaaggttgataataggaagtttggactt
actttccaaagccctgcggatgcacgagcctttgacaggggcgtgagaaaagccatcgaa
gaccttatagaaggttcaacaacctcctcttccacgatccataacgaagctgagctcgga
gacgatgacgtttttacaactgccacagacagttcttctaattcctcgcagaagagggag
ccgaatacaaggacaatctcctcccccacatcgtgcgagcaccggaggatttataccctt
gacccgtaccccatggatctttaccaccccgaccagcgtttgccgcggtcctacccccag
gtcaccttcccggaagatgatgaagagatagtacgcatcaacccccgagagaagatctgg
atgacgggttacgaagattaccggcacgcgccagtccgcggcaaatacttggacagcacc
gaagacgcagactcctacgtgcgcttcgccaagggtgaagtccccaaacacgaatatacg
tatccctacgttgattcttcggactttggcttcggcgaggatcccaaaggcaatgtgatc
aagacacagccgcccagggccaagtcccgtcggcggaaggagaacggcgaacggtcgcgg
tgcgtgtactgcagggacatgttcaaccacgaagagaacagaaggggccactgccaagac
gcgcccgacgccgtgagaacgtgcattcgccgggtgagctgtatgtggtgcgcggacagc
atgctgtaccactgcatgtccgaccccgagggagactacactgacccttgttcgtgcgac
acaagcgacgagaagttttgcctccggtggatggcactaattgccttgtctttcttggct
ccttgtatgtgctgttacctgcccctccgggcctgccaccactgtggagtgatgtgcagg
tgctgtggtgggaagcacaaagccgctgcgtga

DBGET integrated database retrieval system