KEGG   Rattus norvegicus (rat): 305549Help
Entry
305549            CDS       T01003                                 

Gene name
Peli1
Definition
(RefSeq) pellino E3 ubiquitin protein ligase 1
  KO
K11964  pellino [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    305549 (Peli1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     305549 (Peli1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    305549 (Peli1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pellino zf-RING_5 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 305549
NCBI-ProteinID: NP_001094035
RGD: 1311199
Ensembl: ENSRNOG00000006329
UniProt: B2RYE1 Q562B8
Position
14q22
AA seq 418 aa AA seqDB search
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIA
CTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPG
SQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQM
DGLTTNGVLVMHPRDGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQD
GSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPP
THAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcctgatcaagaaaatcatccttccaaagccccagtaaaatatggcgaactc
attgtcttagggtataatgggtctctcccaaacggcgacagaggaaggaggaaaagtagg
tttgctttgtttaaaagacctaaggcaaatggggtgaagcctagcaccgtgcacattgca
tgcactcctcaggccgccaaggcaataagcaacaaggaccagcatagcatatcgtatact
ttatctcgagcccagacagtggtggttgaatatactcacgacagcaacactgatatgttt
cagattggccggtcaactgaaagtcctattgattttgtggtaactgacacagttcctgga
agtcagagtaattccgacacgcagtccgtacaaagcactatatcgaggtttgcctgtagg
atcatttgtgaacgcaatcctccctttacagctcggatttatgctgcaggatttgattca
tcaaaaaacatctttcttggggagaaggctgccaaatggaagacgtccgacgggcagatg
gacggcctgaccaccaatggagttcttgtgatgcatccacgcgatgggttcacagaagac
tccaagcctggaatatggagagagatatccgtatgtgggaacgtcttcagtctgcgtgaa
accagatcagcgcaacagagaggaaagatggtggaaatcgaaaccaatcagctgcaagat
ggctccttaatcgacctctgtggtgcaaccctgctgtggcgcacagcagaaggcctttcc
cacacccctactgtgaaacacttagaagctctgagacaggagatcaatgcagctcggcct
cagtgccctgtaggcttcaacacactagccttccccagcatgaagaggaaagatgttgta
gatgagaagcaaccatgggtatatctgaactgcggccatgttcatggttaccataactgg
ggaaacaaggaagaacgtgacggcaaagatcgtgaatgtcctatgtgtaggtctgttggt
ccctatgtccctctgtggcttggatgtgaagctggattttatgtggacgccggccctccc
acccatgcctttagcccctgtgggcatgtgtgttcagaaaagacaacggcttactggtcc
cagatcccgcttcctcatggtacgcacacttttcacgcagcctgtcccttctgtgcacat
cagttggctggtgaacaaggctatatcagacttattttccaaggacctctagactag

DBGET integrated database retrieval system