KEGG   Rattus norvegicus (rat): 305552Help
Entry
305552            CDS       T01003                                 

Gene name
Wdpcp, RGD1309501
Definition
(RefSeq) WD repeat containing planar cell polarity effector
  KO
K22863  WD repeat-containing and planar cell polarity effector protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    305552 (Wdpcp)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   CPLANE complex
    305552 (Wdpcp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frtz HPS3_N
Motif
Other DBs
NCBI-GeneID: 305552
NCBI-ProteinID: NP_001121009
RGD: 1309501
Ensembl: ENSRNOG00000054331
UniProt: B1WC10
Position
14q22
AA seq 726 aa AA seqDB search
MSFCLTELHLWSLKSTLHIADRDIGVYQYYDKKDLPVSAAEHGNLEEKQRLAESRDYPWT
LKNRRPEKLRDSLKELEELMQNSQCVLCQWKSKHICQLLFGSGVLVSLSLSGPQLEKVVI
DRSLVGKLISDTISDALLTDSFIILSFLAQNKLCFIQFAKKMDSLDVNKRLEKLSALDYK
ISYHDIPGPATRTVDRHLAINSTQDLAVCWWPLLSDDAWPWTPIASEKDRANMLLLGFTQ
GGLEVLSSVRTEWNPLDVHFGTRQPYQVFTVECSFSVDQEPMADSCIYESVRNKLHCVSV
TRIPLRSKAISCCKNSTEDKLIVGCEDSSVILYEAHRGVTLLAQAELMPSLISCHPSGAI
LLVGSNQGELQVFDIALSPINIQLLAEDCLPKETLQFNKFFDFSSSLVHMQWIAPPIVFQ
KPKRGEICDLLFLRFNRGPLGVLLFKLGVLRRGQLGLVDLIFQYIHCDEVYEAVSVLSSM
NWDTLGQQCFISMSTIVNHLLRQRLTPEREAQLEASLGTFYAPARPLLDTTVLAYRDPVG
TYARRLFHHLLRYQRFEKAFLLAVDIGARDLFMDIHYLALDMGELALAEVARRRADDIDV
ESVCSGVELLGPLDRRDMLNEGFAGSALTPEGGNPFPDLLPSSGSTPKHTIQQKIPNGPS
NRRAIERKNEVMEETEEEEEEEEEAAACTDSSVATTWDAEGELREDHRRQDTEDVGSLRM
VHFGLV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctgcttgactgaactgcacctgtggtctctgaaaagcaccttacacattgcg
gatagagacatcggcgtctaccagtactatgacaagaaagatctaccagtatcagcagca
gagcatggtaacttagaagaaaaacaaaggctggcagaatcacgagattatccttggaca
ctcaaaaatagacgcccagaaaaacttcgagattcactgaaagagttggaggaactgatg
cagaacagtcagtgtgtgctgtgccaatggaagagcaaacacatctgtcagctcctcttt
ggttcaggtgtgctggtgtccctaagcctttctgggcctcagctggagaaagtggtgatt
gacaggagcctggtggggaagctcatctcagacaccatcagtgatgctctccttacagac
agtttcatcatcttatcatttctggcacaaaacaaattatgttttattcaatttgcaaag
aagatggattctcttgatgtaaacaagaggttggaaaagctctcagccttggattataag
atttcctaccatgacatacctggcccagccaccaggacagtagatcgtcacttagccatc
aactccactcaggatctagctgtttgctggtggcctctgctcagcgatgatgcttggcct
tggactccgatcgcttctgagaaggacagagccaatatgctgctcctgggctttactcaa
ggaggattggaggtcctgagctctgttcgcacagaatggaatcctctggatgttcacttt
ggcaccagacaaccttatcaggtgttcacagtggagtgctccttcagtgtagaccaggag
cccatggctgacagctgtatctacgagtctgtccggaacaaactccattgcgtgtcagtt
actagaataccactaaggtcgaaggccatcagctgctgtaagaattctacggaagacaaa
ctgattgtgggctgtgaagactcgtccgtaattctctatgaagctcaccgtggagtgact
ctcttggcccaggctgaacttatgccttcattaataagctgccacccaagtggtgccatt
ctgctggttggcagcaaccaaggggaattacaagtttttgacattgctctgtcccctatc
aacatccagctcttggcagaagattgcttaccaaaggagactctgcaattcaataaattc
tttgatttttccagcagtcttgttcatatgcagtggatagctcctcccattgttttccag
aagcctaagagaggagaaatctgtgatctcctcttcctcaggttcaacagaggacctttg
ggtgtgctgttgtttaaacttggtgtcctcaggcgagggcagctgggcctggtggacctt
atcttccagtacattcactgtgatgaggtgtacgaggccgtcagcgttctgagcagcatg
aactgggacaccctggggcagcagtgcttcatcagcatgagcaccattgtgaaccatctt
ctcagacagaggctcactccggagagggaagcacagcttgaggcaagccttggaaccttc
tatgctccagcgagaccgcttctggatacaactgttctggcatacagagacccggttggc
acgtacgccaggaggctcttccaccacttgctcaggtaccagagatttgaaaaggccttt
cttctagcggttgacattggagctcgtgacctgttcatggatattcattaccttgccctg
gatatgggtgagctggcactggctgaagtggcaagaagaagggcagatgacattgatgtc
gagtcagtgtgctctggagtcgaactcctgggacccttggacagaagagacatgctgaat
gaaggttttgccggctcagctttaacacctgaaggaggaaacccatttccagaccttctt
ccttccagtggttcaacacccaagcatactattcaacagaaaataccaaatggcccttca
aacagacgggcaattgaaagaaagaatgaggtgatggaggagacagaggaggaagaggag
gaggaggaggaggcagcggcctgcactgactcttcagtggctaccacctgggatgcagaa
ggagaactgagggaagaccacaggagacaggacactgaagatgttggttctctcagaatg
gttcactttggtttggtgtaa

DBGET integrated database retrieval system